Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4368351..4368969 | Replicon | chromosome |
| Accession | NZ_CP099906 | ||
| Organism | Escherichia albertii strain 121_1_EW_A | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIY90_RS21055 | Protein ID | WP_001280991.1 |
| Coordinates | 4368351..4368569 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | NIY90_RS21060 | Protein ID | WP_000344798.1 |
| Coordinates | 4368595..4368969 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY90_RS21020 (4363641) | 4363641..4364213 | + | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
| NIY90_RS21025 (4364243) | 4364243..4364554 | - | 312 | WP_000409915.1 | MGMT family protein | - |
| NIY90_RS21035 (4364935) | 4364935..4365288 | + | 354 | WP_000878151.1 | DUF1428 family protein | - |
| NIY90_RS21040 (4365326) | 4365326..4366876 | - | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| NIY90_RS21045 (4367040) | 4367040..4367510 | - | 471 | WP_059224581.1 | YlaC family protein | - |
| NIY90_RS21050 (4367617) | 4367617..4368174 | - | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| NIY90_RS21055 (4368351) | 4368351..4368569 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIY90_RS21060 (4368595) | 4368595..4368969 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| NIY90_RS21065 (4369524) | 4369524..4372673 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIY90_RS21070 (4372696) | 4372696..4373889 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249888 WP_001280991.1 NZ_CP099906:c4368569-4368351 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249888 WP_000344798.1 NZ_CP099906:c4368969-4368595 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|