Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 2797367..2798167 | Replicon | chromosome |
Accession | NZ_CP099906 | ||
Organism | Escherichia albertii strain 121_1_EW_A |
Toxin (Protein)
Gene name | ataT | Uniprot ID | B1EHN9 |
Locus tag | NIY90_RS13700 | Protein ID | WP_000342453.1 |
Coordinates | 2797367..2797894 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | B1EHP0 |
Locus tag | NIY90_RS13705 | Protein ID | WP_001277106.1 |
Coordinates | 2797901..2798167 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY90_RS13675 (2792442) | 2792442..2793209 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NIY90_RS13680 (2793206) | 2793206..2794483 | - | 1278 | WP_256879194.1 | branched chain amino acid ABC transporter permease LivM | - |
NIY90_RS13685 (2794480) | 2794480..2795406 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NIY90_RS13690 (2795454) | 2795454..2796563 | - | 1110 | WP_256879195.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NIY90_RS13695 (2796987) | 2796987..2797370 | + | 384 | WP_000778774.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
NIY90_RS13700 (2797367) | 2797367..2797894 | - | 528 | WP_000342453.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
NIY90_RS13705 (2797901) | 2797901..2798167 | - | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
NIY90_RS13710 (2798317) | 2798317..2799420 | - | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
NIY90_RS13715 (2799943) | 2799943..2800344 | + | 402 | WP_001071334.1 | PTS sugar transporter subunit IIA | - |
NIY90_RS13720 (2800351) | 2800351..2800836 | + | 486 | WP_000029259.1 | PTS sugar transporter subunit IIB | - |
NIY90_RS13725 (2800853) | 2800853..2801599 | + | 747 | WP_000151888.1 | PTS sugar transporter subunit IIC | - |
NIY90_RS13730 (2801592) | 2801592..2802446 | + | 855 | WP_000370584.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19676.58 Da Isoelectric Point: 6.9585
>T249879 WP_000342453.1 NZ_CP099906:c2797894-2797367 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|