Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 64625..65268 | Replicon | plasmid plas2 |
| Accession | NZ_CP099905 | ||
| Organism | Escherichia albertii strain 133_1_GWG_A | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NIY95_RS24840 | Protein ID | WP_256876211.1 |
| Coordinates | 64625..65041 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NIY95_RS24845 | Protein ID | WP_256876210.1 |
| Coordinates | 65038..65268 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY95_RS24815 (59676) | 59676..60017 | - | 342 | Protein_62 | protein RepA | - |
| NIY95_RS24820 (60554) | 60554..61150 | - | 597 | WP_256876215.1 | hypothetical protein | - |
| NIY95_RS24825 (61138) | 61138..61407 | - | 270 | WP_256876214.1 | hypothetical protein | - |
| NIY95_RS24830 (61726) | 61726..63297 | + | 1572 | WP_256876213.1 | ATP-binding protein | - |
| NIY95_RS24835 (63505) | 63505..64485 | - | 981 | WP_256876212.1 | hypothetical protein | - |
| NIY95_RS24840 (64625) | 64625..65041 | - | 417 | WP_256876211.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIY95_RS24845 (65038) | 65038..65268 | - | 231 | WP_256876210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIY95_RS24850 (65837) | 65837..66250 | + | 414 | WP_000465043.1 | hypothetical protein | - |
| NIY95_RS24855 (66252) | 66252..67034 | + | 783 | WP_021533580.1 | site-specific integrase | - |
| NIY95_RS24860 (67207) | 67207..67560 | + | 354 | WP_000864812.1 | colicin M immunity protein | - |
| NIY95_RS24865 (67610) | 67610..68425 | - | 816 | WP_000449473.1 | lipid II-degrading bacteriocin colicin M | - |
| NIY95_RS24870 (68668) | 68668..69195 | + | 528 | WP_000203268.1 | colicin B immunity protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 | 1..89077 | 89077 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.41 Da Isoelectric Point: 6.7125
>T249864 WP_256876211.1 NZ_CP099905:c65041-64625 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|