Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2385137..2385663 | Replicon | chromosome |
| Accession | NZ_CP099903 | ||
| Organism | Escherichia albertii strain 133_1_GWG_A | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | NIY95_RS11680 | Protein ID | WP_000323025.1 |
| Coordinates | 2385376..2385663 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | NIY95_RS11675 | Protein ID | WP_000534858.1 |
| Coordinates | 2385137..2385376 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY95_RS11635 (2380323) | 2380323..2380550 | + | 228 | WP_000476993.1 | Cro/CI family transcriptional regulator | - |
| NIY95_RS11640 (2380534) | 2380534..2381055 | + | 522 | WP_000705349.1 | toxin YdaT family protein | - |
| NIY95_RS11645 (2381036) | 2381036..2382001 | + | 966 | WP_000054504.1 | hypothetical protein | - |
| NIY95_RS11650 (2382042) | 2382042..2382461 | + | 420 | WP_001151196.1 | DUF977 family protein | - |
| NIY95_RS11655 (2382516) | 2382516..2383565 | + | 1050 | Protein_2274 | ISNCY family transposase | - |
| NIY95_RS11660 (2383686) | 2383686..2383835 | + | 150 | WP_180302674.1 | protein YdfW | - |
| NIY95_RS11665 (2384272) | 2384272..2384604 | - | 333 | WP_001317460.1 | FlxA-like family protein | - |
| NIY95_RS11670 (2384807) | 2384807..2385112 | - | 306 | WP_071527819.1 | protein YdfV | - |
| NIY95_RS11675 (2385137) | 2385137..2385376 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| NIY95_RS11680 (2385376) | 2385376..2385663 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| NIY95_RS11685 (2385735) | 2385735..2385890 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| NIY95_RS11690 (2386107) | 2386107..2386358 | + | 252 | WP_000980994.1 | protein Rem | - |
| NIY95_RS11695 (2386425) | 2386425..2386703 | + | 279 | WP_012304870.1 | hypothetical protein | - |
| NIY95_RS11700 (2386705) | 2386705..2387754 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| NIY95_RS11705 (2387768) | 2387768..2388520 | + | 753 | WP_001047135.1 | antitermination protein | - |
| NIY95_RS11710 (2388798) | 2388798..2388887 | - | 90 | WP_120795389.1 | hypothetical protein | - |
| NIY95_RS11715 (2388942) | 2388942..2389154 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| NIY95_RS11720 (2389455) | 2389455..2389670 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| NIY95_RS11725 (2390034) | 2390034..2390204 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2362048..2423695 | 61647 | |
| - | inside | Prophage | - | - | 2356920..2423695 | 66775 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T249849 WP_000323025.1 NZ_CP099903:2385376-2385663 [Escherichia albertii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|