Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1923224..1923814 | Replicon | chromosome |
| Accession | NZ_CP099903 | ||
| Organism | Escherichia albertii strain 133_1_GWG_A | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | NIY95_RS09180 | Protein ID | WP_059225520.1 |
| Coordinates | 1923482..1923814 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | NIY95_RS09175 | Protein ID | WP_059225519.1 |
| Coordinates | 1923224..1923481 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY95_RS09165 (1922204) | 1922204..1922674 | + | 471 | WP_059225518.1 | hypothetical protein | - |
| NIY95_RS09170 (1922671) | 1922671..1922876 | + | 206 | Protein_1789 | helix-turn-helix domain-containing protein | - |
| NIY95_RS09175 (1923224) | 1923224..1923481 | + | 258 | WP_059225519.1 | hypothetical protein | Antitoxin |
| NIY95_RS09180 (1923482) | 1923482..1923814 | + | 333 | WP_059225520.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NIY95_RS09185 (1923927) | 1923927..1924304 | + | 378 | WP_161537949.1 | hypothetical protein | - |
| NIY95_RS09190 (1924622) | 1924622..1925506 | + | 885 | WP_059225521.1 | integrase domain-containing protein | - |
| NIY95_RS09195 (1925602) | 1925602..1925889 | - | 288 | WP_059225522.1 | hypothetical protein | - |
| NIY95_RS09200 (1926848) | 1926848..1928110 | - | 1263 | WP_059225524.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11777.59 Da Isoelectric Point: 8.0291
>T249844 WP_059225520.1 NZ_CP099903:1923482-1923814 [Escherichia albertii]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|