Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 298198..298998 | Replicon | chromosome |
| Accession | NZ_CP099903 | ||
| Organism | Escherichia albertii strain 133_1_GWG_A | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | NIY95_RS01385 | Protein ID | WP_059225129.1 |
| Coordinates | 298471..298998 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | NIY95_RS01380 | Protein ID | WP_001277106.1 |
| Coordinates | 298198..298464 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY95_RS01360 (293855) | 293855..294523 | + | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
| NIY95_RS01365 (294516) | 294516..295574 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
| NIY95_RS01370 (295819) | 295819..296673 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| NIY95_RS01375 (296945) | 296945..298048 | + | 1104 | WP_072248450.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NIY95_RS01380 (298198) | 298198..298464 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NIY95_RS01385 (298471) | 298471..298998 | + | 528 | WP_059225129.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NIY95_RS01390 (298995) | 298995..299378 | - | 384 | WP_000778776.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NIY95_RS01395 (299802) | 299802..300911 | + | 1110 | Protein_275 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NIY95_RS01400 (300959) | 300959..301885 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NIY95_RS01405 (301882) | 301882..303159 | + | 1278 | WP_059225128.1 | branched chain amino acid ABC transporter permease LivM | - |
| NIY95_RS01410 (303156) | 303156..303923 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19690.60 Da Isoelectric Point: 6.9585
>T249841 WP_059225129.1 NZ_CP099903:298471-298998 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|