Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 27473..28008 Replicon plasmid plas4
Accession NZ_CP099902
Organism Escherichia albertii strain 147_1_TBG_A

Toxin (Protein)


Gene name relE Uniprot ID T2HS21
Locus tag NIZ13_RS24430 Protein ID WP_000222775.1
Coordinates 27721..28008 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID T2HSA2
Locus tag NIZ13_RS24425 Protein ID WP_001139207.1
Coordinates 27473..27724 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ13_RS24385 (NIZ13_24370) 22580..22798 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA -
NIZ13_RS24390 (NIZ13_24375) 22800..23105 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NIZ13_RS24395 (NIZ13_24380) 23106..23914 + 809 Protein_25 site-specific integrase -
NIZ13_RS24400 (NIZ13_24385) 24094..24738 + 645 WP_001144036.1 ParA family protein -
NIZ13_RS24405 (NIZ13_24390) 24825..25133 + 309 WP_000030204.1 molecular chaperone GroEL -
NIZ13_RS24410 (NIZ13_24395) 25545..26525 + 981 WP_256875926.1 plasmid segregation protein ParM -
NIZ13_RS24415 (NIZ13_24400) 26518..26934 + 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ13_RS24420 (NIZ13_24405) 26936..27358 - 423 Protein_30 DUF4113 domain-containing protein -
NIZ13_RS24425 (NIZ13_24410) 27473..27724 + 252 WP_001139207.1 plasmid stabilization protein Antitoxin
NIZ13_RS24430 (NIZ13_24415) 27721..28008 + 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIZ13_RS24435 (NIZ13_24420) 28018..28389 + 372 WP_256875924.1 hypothetical protein -
NIZ13_RS24440 (NIZ13_24425) 29290..29876 + 587 Protein_34 serine acetyltransferase -
NIZ13_RS24445 (NIZ13_24430) 30156..30749 - 594 WP_001523457.1 ProQ/FINO family protein -
NIZ13_RS24450 (NIZ13_24435) 31752..32516 + 765 WP_256875923.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / espL2 1..79674 79674


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11142.17 Da        Isoelectric Point: 10.6261

>T249839 WP_000222775.1 NZ_CP099902:27721-28008 [Escherichia albertii]
MTYTVKFRDDALREWLKLDKSVQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSHVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9216.45 Da        Isoelectric Point: 4.0927

>AT249839 WP_001139207.1 NZ_CP099902:27473-27724 [Escherichia albertii]
MPSIILSDTSASVSELKKNPMATVSAGEGYPVAILNRNQPAFYCVPAELYERMLDAMDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB T2HS21

Antitoxin

Source ID Structure
AlphaFold DB A0A754EQ65

References