Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 22580..23105 Replicon plasmid plas4
Accession NZ_CP099902
Organism Escherichia albertii strain 147_1_TBG_A

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NIZ13_RS24390 Protein ID WP_001159871.1
Coordinates 22800..23105 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag NIZ13_RS24385 Protein ID WP_000813639.1
Coordinates 22580..22798 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ13_RS24350 (NIZ13_24335) 18144..19736 - 1593 WP_256878671.1 IS66 family transposase -
NIZ13_RS24355 (NIZ13_24340) 19767..20117 - 351 WP_000624718.1 IS66 family insertion sequence element accessory protein TnpB -
NIZ13_RS24360 (NIZ13_24345) 20114..20533 - 420 WP_065106474.1 transposase -
NIZ13_RS24365 (NIZ13_24350) 20620..20805 + 186 Protein_19 transposase -
NIZ13_RS24370 (NIZ13_24355) 20801..21070 - 270 Protein_20 site-specific integrase -
NIZ13_RS24375 (NIZ13_24360) 21130..21726 - 597 WP_059217960.1 hypothetical protein -
NIZ13_RS24380 (NIZ13_24365) 21714..21983 - 270 WP_000343793.1 hypothetical protein -
NIZ13_RS24385 (NIZ13_24370) 22580..22798 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIZ13_RS24390 (NIZ13_24375) 22800..23105 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NIZ13_RS24395 (NIZ13_24380) 23106..23914 + 809 Protein_25 site-specific integrase -
NIZ13_RS24400 (NIZ13_24385) 24094..24738 + 645 WP_001144036.1 ParA family protein -
NIZ13_RS24405 (NIZ13_24390) 24825..25133 + 309 WP_000030204.1 molecular chaperone GroEL -
NIZ13_RS24410 (NIZ13_24395) 25545..26525 + 981 WP_256875926.1 plasmid segregation protein ParM -
NIZ13_RS24415 (NIZ13_24400) 26518..26934 + 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ13_RS24420 (NIZ13_24405) 26936..27358 - 423 Protein_30 DUF4113 domain-containing protein -
NIZ13_RS24425 (NIZ13_24410) 27473..27724 + 252 WP_001139207.1 plasmid stabilization protein -
NIZ13_RS24430 (NIZ13_24415) 27721..28008 + 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / espL2 1..79674 79674


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T249838 WP_001159871.1 NZ_CP099902:22800-23105 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT249838 WP_000813639.1 NZ_CP099902:22580-22798 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References