249837

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 36225..36726 Replicon plasmid plas3
Accession NZ_CP099901
Organism Escherichia albertii strain 147_1_TBG_A

Toxin (Protein)


Gene name TsxA Uniprot ID H1ZXU8
Locus tag NIZ13_RS24175 Protein ID WP_000702247.1
Coordinates 36225..36485 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag NIZ13_RS24180 Protein ID WP_001132407.1
Coordinates 36475..36726 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ13_RS24130 (NIZ13_24115) 31763..31915 + 153 Protein_41 FlmC family protein -
NIZ13_RS24135 (NIZ13_24120) 31863..31982 + 120 WP_227525580.1 Hok/Gef family protein -
NIZ13_RS24140 (NIZ13_24125) 32132..32728 + 597 WP_000125165.1 ProQ/FINO family protein -
NIZ13_RS24145 (NIZ13_24130) 32746..33030 - 285 WP_001162371.1 hypothetical protein -
NIZ13_RS24150 (NIZ13_24135) 33104..33769 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
NIZ13_RS24155 (NIZ13_24140) 34368..34697 + 330 WP_000855120.1 hypothetical protein -
NIZ13_RS24160 (NIZ13_24145) 35279..35602 + 324 WP_000427403.1 hypothetical protein -
NIZ13_RS24165 (NIZ13_24150) 35643..35852 + 210 WP_000866037.1 hypothetical protein -
NIZ13_RS24170 (NIZ13_24155) 35949..36173 + 225 WP_000814381.1 hypothetical protein -
NIZ13_RS24175 (NIZ13_24160) 36225..36485 + 261 WP_000702247.1 hypothetical protein Toxin
NIZ13_RS24180 (NIZ13_24165) 36475..36726 + 252 WP_001132407.1 transcriptional regulator Antitoxin
NIZ13_RS24185 (NIZ13_24170) 37276..37554 + 279 WP_000545938.1 hypothetical protein -
NIZ13_RS24190 (NIZ13_24175) 37816..39042 - 1227 WP_119967402.1 RNA-guided endonuclease TnpB family protein -
NIZ13_RS24195 (NIZ13_24180) 39101..39505 + 405 WP_053001740.1 IS200/IS605 family transposase -
NIZ13_RS24200 (NIZ13_24185) 39759..40202 - 444 WP_226454421.1 hypothetical protein -
NIZ13_RS24205 (NIZ13_24190) 40499..40681 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
NIZ13_RS24210 (NIZ13_24195) 40706..41143 + 438 WP_023225990.1 type II toxin-antitoxin system HicB family antitoxin -
NIZ13_RS24215 (NIZ13_24200) 41274..41600 - 327 WP_000206701.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..53352 53352


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9817.29 Da        Isoelectric Point: 10.0665

>T249837 WP_000702247.1 NZ_CP099901:36225-36485 [Escherichia albertii]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT249837 WP_001132407.1 NZ_CP099901:36475-36726 [Escherichia albertii]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1P8DNC0

Antitoxin

Source ID Structure

References