Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3431625..3432243 | Replicon | chromosome |
| Accession | NZ_CP099898 | ||
| Organism | Escherichia albertii strain 147_1_TBG_A | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIZ13_RS16825 | Protein ID | WP_001280991.1 |
| Coordinates | 3432025..3432243 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | NIZ13_RS16820 | Protein ID | WP_000344798.1 |
| Coordinates | 3431625..3431999 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ13_RS16810 (3426705) | 3426705..3427898 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIZ13_RS16815 (3427921) | 3427921..3431070 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIZ13_RS16820 (3431625) | 3431625..3431999 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| NIZ13_RS16825 (3432025) | 3432025..3432243 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIZ13_RS16830 (3432420) | 3432420..3432977 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| NIZ13_RS16835 (3433084) | 3433084..3433554 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| NIZ13_RS16840 (3433718) | 3433718..3435268 | + | 1551 | WP_059234326.1 | EAL domain-containing protein | - |
| NIZ13_RS16845 (3435306) | 3435306..3435659 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| NIZ13_RS16855 (3436040) | 3436040..3436351 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| NIZ13_RS16860 (3436381) | 3436381..3436953 | - | 573 | WP_256875765.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249828 WP_001280991.1 NZ_CP099898:3432025-3432243 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249828 WP_000344798.1 NZ_CP099898:3431625-3431999 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|