Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 297802..298602 | Replicon | chromosome |
| Accession | NZ_CP099898 | ||
| Organism | Escherichia albertii strain 147_1_TBG_A | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A8H9C5V7 |
| Locus tag | NIZ13_RS01375 | Protein ID | WP_000342455.1 |
| Coordinates | 298075..298602 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | NIZ13_RS01370 | Protein ID | WP_001277106.1 |
| Coordinates | 297802..298068 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ13_RS01350 (293398) | 293398..294456 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
| NIZ13_RS01355 (294701) | 294701..295555 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| NIZ13_RS01360 (295752) | 295752..296261 | + | 510 | WP_059235675.1 | hypothetical protein | - |
| NIZ13_RS01365 (296549) | 296549..297652 | + | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NIZ13_RS01370 (297802) | 297802..298068 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NIZ13_RS01375 (298075) | 298075..298602 | + | 528 | WP_000342455.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NIZ13_RS01380 (298599) | 298599..298982 | - | 384 | WP_059235673.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NIZ13_RS01385 (299406) | 299406..300515 | + | 1110 | WP_256875830.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NIZ13_RS01390 (300563) | 300563..301489 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NIZ13_RS01395 (301486) | 301486..302763 | + | 1278 | WP_044709902.1 | branched chain amino acid ABC transporter permease LivM | - |
| NIZ13_RS01400 (302760) | 302760..303527 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19607.47 Da Isoelectric Point: 6.6343
>T249817 WP_000342455.1 NZ_CP099898:298075-298602 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|