Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 142032..142644 | Replicon | chromosome |
Accession | NZ_CP099898 | ||
Organism | Escherichia albertii strain 147_1_TBG_A |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | NIZ13_RS00620 | Protein ID | WP_000833473.1 |
Coordinates | 142032..142217 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NIZ13_RS00625 | Protein ID | WP_059235556.1 |
Coordinates | 142234..142644 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ13_RS00605 (137496) | 137496..138791 | + | 1296 | WP_059235552.1 | Fic family protein | - |
NIZ13_RS00610 (138899) | 138899..140437 | + | 1539 | WP_002460288.1 | aldehyde dehydrogenase AldB | - |
NIZ13_RS00615 (140478) | 140478..141557 | - | 1080 | WP_025238097.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
NIZ13_RS00620 (142032) | 142032..142217 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NIZ13_RS00625 (142234) | 142234..142644 | + | 411 | WP_059235556.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NIZ13_RS00630 (142716) | 142716..144680 | - | 1965 | WP_256875795.1 | glycoside hydrolase family 127 protein | - |
NIZ13_RS00635 (144691) | 144691..146091 | - | 1401 | WP_025238099.1 | MFS transporter | - |
NIZ13_RS00640 (146317) | 146317..147132 | + | 816 | WP_059242247.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T249815 WP_000833473.1 NZ_CP099898:142032-142217 [Escherichia albertii]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15193.10 Da Isoelectric Point: 4.5486
>AT249815 WP_059235556.1 NZ_CP099898:142234-142644 [Escherichia albertii]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQVEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQVEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|