Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 27194..27719 Replicon plasmid plas2
Accession NZ_CP099897
Organism Escherichia albertii strain 153_2_TBG_A

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NIZ14_RS23785 Protein ID WP_001159871.1
Coordinates 27194..27499 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag NIZ14_RS23790 Protein ID WP_000813639.1
Coordinates 27501..27719 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ14_RS23745 (NIZ14_23730) 22291..22578 - 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin -
NIZ14_RS23750 (NIZ14_23735) 22575..22826 - 252 WP_001139207.1 plasmid stabilization protein -
NIZ14_RS23755 (NIZ14_23740) 22941..23363 + 423 Protein_32 DUF4113 domain-containing protein -
NIZ14_RS23760 (NIZ14_23745) 23365..23781 - 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ14_RS23765 (NIZ14_23750) 23774..24754 - 981 WP_256875926.1 plasmid segregation protein ParM -
NIZ14_RS23770 (NIZ14_23755) 25166..25474 - 309 WP_000030204.1 molecular chaperone GroEL -
NIZ14_RS23775 (NIZ14_23760) 25561..26205 - 645 WP_001144036.1 ParA family protein -
NIZ14_RS23780 (NIZ14_23765) 26385..27193 - 809 Protein_37 site-specific integrase -
NIZ14_RS23785 (NIZ14_23770) 27194..27499 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NIZ14_RS23790 (NIZ14_23775) 27501..27719 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIZ14_RS23795 (NIZ14_23780) 28316..28585 + 270 WP_000343793.1 hypothetical protein -
NIZ14_RS23800 (NIZ14_23785) 28573..29169 + 597 WP_059217960.1 hypothetical protein -
NIZ14_RS23805 (NIZ14_23790) 29229..29498 + 270 Protein_42 site-specific integrase -
NIZ14_RS23810 (NIZ14_23795) 29494..29679 - 186 Protein_43 transposase -
NIZ14_RS23815 (NIZ14_23800) 29766..30185 + 420 WP_065106474.1 transposase -
NIZ14_RS23820 (NIZ14_23805) 30182..30532 + 351 WP_000624718.1 IS66 family insertion sequence element accessory protein TnpB -
NIZ14_RS23825 (NIZ14_23810) 30563..32155 + 1593 WP_256878671.1 IS66 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeI / faeH / espL2 1..79672 79672


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T249814 WP_001159871.1 NZ_CP099897:c27499-27194 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT249814 WP_000813639.1 NZ_CP099897:c27719-27501 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References