Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 22291..22826 Replicon plasmid plas2
Accession NZ_CP099897
Organism Escherichia albertii strain 153_2_TBG_A

Toxin (Protein)


Gene name relE Uniprot ID T2HS21
Locus tag NIZ14_RS23745 Protein ID WP_000222775.1
Coordinates 22291..22578 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID T2HSA2
Locus tag NIZ14_RS23750 Protein ID WP_001139207.1
Coordinates 22575..22826 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ14_RS23725 (NIZ14_23710) 17783..18547 - 765 WP_256875923.1 helix-turn-helix domain-containing protein -
NIZ14_RS23730 (NIZ14_23715) 19550..20143 + 594 WP_001523457.1 ProQ/FINO family protein -
NIZ14_RS23735 (NIZ14_23720) 20423..21009 - 587 Protein_28 serine acetyltransferase -
NIZ14_RS23740 (NIZ14_23725) 21910..22281 - 372 WP_256875924.1 hypothetical protein -
NIZ14_RS23745 (NIZ14_23730) 22291..22578 - 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIZ14_RS23750 (NIZ14_23735) 22575..22826 - 252 WP_001139207.1 plasmid stabilization protein Antitoxin
NIZ14_RS23755 (NIZ14_23740) 22941..23363 + 423 Protein_32 DUF4113 domain-containing protein -
NIZ14_RS23760 (NIZ14_23745) 23365..23781 - 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ14_RS23765 (NIZ14_23750) 23774..24754 - 981 WP_256875926.1 plasmid segregation protein ParM -
NIZ14_RS23770 (NIZ14_23755) 25166..25474 - 309 WP_000030204.1 molecular chaperone GroEL -
NIZ14_RS23775 (NIZ14_23760) 25561..26205 - 645 WP_001144036.1 ParA family protein -
NIZ14_RS23780 (NIZ14_23765) 26385..27193 - 809 Protein_37 site-specific integrase -
NIZ14_RS23785 (NIZ14_23770) 27194..27499 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NIZ14_RS23790 (NIZ14_23775) 27501..27719 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeI / faeH / espL2 1..79672 79672


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11142.17 Da        Isoelectric Point: 10.6261

>T249813 WP_000222775.1 NZ_CP099897:c22578-22291 [Escherichia albertii]
MTYTVKFRDDALREWLKLDKSVQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSHVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9216.45 Da        Isoelectric Point: 4.0927

>AT249813 WP_001139207.1 NZ_CP099897:c22826-22575 [Escherichia albertii]
MPSIILSDTSASVSELKKNPMATVSAGEGYPVAILNRNQPAFYCVPAELYERMLDAMDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB T2HS21

Antitoxin

Source ID Structure
AlphaFold DB A0A754EQ65

References