Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 110678..111476 | Replicon | plasmid plas1 |
Accession | NZ_CP099896 | ||
Organism | Escherichia albertii strain 153_2_TBG_A |
Toxin (Protein)
Gene name | ataT | Uniprot ID | E2QDF3 |
Locus tag | NIZ14_RS23540 | Protein ID | WP_000072677.1 |
Coordinates | 110955..111476 (+) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
Locus tag | NIZ14_RS23535 | Protein ID | WP_001351987.1 |
Coordinates | 110678..110947 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ14_RS23510 (NIZ14_23495) | 106106..107446 | - | 1341 | WP_000137333.1 | DnaB-like helicase C-terminal domain-containing protein | - |
NIZ14_RS23515 (NIZ14_23500) | 107490..108230 | - | 741 | WP_187192596.1 | hypothetical protein | - |
NIZ14_RS23520 (NIZ14_23505) | 108513..109280 | + | 768 | WP_000342417.1 | hypothetical protein | - |
NIZ14_RS23525 (NIZ14_23510) | 109333..109685 | - | 353 | Protein_122 | hypothetical protein | - |
NIZ14_RS23530 (NIZ14_23515) | 109691..110359 | - | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
NIZ14_RS23535 (NIZ14_23520) | 110678..110947 | + | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
NIZ14_RS23540 (NIZ14_23525) | 110955..111476 | + | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
NIZ14_RS23545 (NIZ14_23530) | 111645..111896 | - | 252 | WP_000901559.1 | hypothetical protein | - |
NIZ14_RS23550 (NIZ14_23535) | 111898..112590 | - | 693 | WP_000856757.1 | hypothetical protein | - |
NIZ14_RS23555 (NIZ14_23540) | 112604..112927 | - | 324 | WP_001717323.1 | hypothetical protein | - |
NIZ14_RS23560 (NIZ14_23545) | 113130..115673 | - | 2544 | WP_256880912.1 | tail fiber protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..124502 | 124502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T249812 WP_000072677.1 NZ_CP099896:110955-111476 [Escherichia albertii]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6P3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6Q7 |