Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 2737..3535 | Replicon | plasmid plas1 |
Accession | NZ_CP099896 | ||
Organism | Escherichia albertii strain 153_2_TBG_A |
Toxin (Protein)
Gene name | ataT | Uniprot ID | E2QDF3 |
Locus tag | NIZ14_RS22915 | Protein ID | WP_000072677.1 |
Coordinates | 3014..3535 (+) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
Locus tag | NIZ14_RS22910 | Protein ID | WP_001351987.1 |
Coordinates | 2737..3006 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ14_RS22895 (NIZ14_22880) | 570..1338 | + | 769 | Protein_0 | hypothetical protein | - |
NIZ14_RS22900 (NIZ14_22885) | 1391..1744 | - | 354 | WP_160378290.1 | hypothetical protein | - |
NIZ14_RS22905 (NIZ14_22890) | 1750..2418 | - | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
NIZ14_RS22910 (NIZ14_22895) | 2737..3006 | + | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
NIZ14_RS22915 (NIZ14_22900) | 3014..3535 | + | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
NIZ14_RS22920 (NIZ14_22905) | 3704..3956 | - | 253 | Protein_5 | hypothetical protein | - |
NIZ14_RS22925 (NIZ14_22910) | 3958..4653 | - | 696 | WP_256880914.1 | hypothetical protein | - |
NIZ14_RS22930 (NIZ14_22915) | 4667..4990 | - | 324 | WP_001717323.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..124502 | 124502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T249811 WP_000072677.1 NZ_CP099896:3014-3535 [Escherichia albertii]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6P3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6Q7 |