Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3481610..3482228 | Replicon | chromosome |
| Accession | NZ_CP099895 | ||
| Organism | Escherichia albertii strain 153_2_TBG_A | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIZ14_RS17065 | Protein ID | WP_001280991.1 |
| Coordinates | 3482010..3482228 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NIZ14_RS17060 | Protein ID | WP_256878553.1 |
| Coordinates | 3481610..3481984 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ14_RS17050 (3476690) | 3476690..3477883 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIZ14_RS17055 (3477906) | 3477906..3481055 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIZ14_RS17060 (3481610) | 3481610..3481984 | + | 375 | WP_256878553.1 | Hha toxicity modulator TomB | Antitoxin |
| NIZ14_RS17065 (3482010) | 3482010..3482228 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIZ14_RS17070 (3482405) | 3482405..3482962 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| NIZ14_RS17075 (3483069) | 3483069..3483539 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| NIZ14_RS17080 (3483703) | 3483703..3485252 | + | 1550 | Protein_3333 | EAL domain-containing protein | - |
| NIZ14_RS17085 (3485290) | 3485290..3485643 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| NIZ14_RS17095 (3486024) | 3486024..3486335 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| NIZ14_RS17100 (3486365) | 3486365..3486937 | - | 573 | WP_256875765.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249803 WP_001280991.1 NZ_CP099895:3482010-3482228 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14455.34 Da Isoelectric Point: 5.1542
>AT249803 WP_256878553.1 NZ_CP099895:3481610-3481984 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|