Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 297144..297944 | Replicon | chromosome |
Accession | NZ_CP099895 | ||
Organism | Escherichia albertii strain 153_2_TBG_A |
Toxin (Protein)
Gene name | ataT | Uniprot ID | A0A8H9C5V7 |
Locus tag | NIZ14_RS01375 | Protein ID | WP_000342455.1 |
Coordinates | 297417..297944 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | B1EHP0 |
Locus tag | NIZ14_RS01370 | Protein ID | WP_001277106.1 |
Coordinates | 297144..297410 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ14_RS01350 (292740) | 292740..293798 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
NIZ14_RS01355 (294043) | 294043..294897 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
NIZ14_RS01360 (295094) | 295094..295603 | + | 510 | WP_059235675.1 | hypothetical protein | - |
NIZ14_RS01365 (295891) | 295891..296994 | + | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
NIZ14_RS01370 (297144) | 297144..297410 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
NIZ14_RS01375 (297417) | 297417..297944 | + | 528 | WP_000342455.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
NIZ14_RS01380 (297941) | 297941..298324 | - | 384 | WP_059235673.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
NIZ14_RS01385 (298748) | 298748..299857 | + | 1110 | WP_256875830.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NIZ14_RS01390 (299905) | 299905..300831 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NIZ14_RS01395 (300828) | 300828..302105 | + | 1278 | WP_044709902.1 | branched chain amino acid ABC transporter permease LivM | - |
NIZ14_RS01400 (302102) | 302102..302869 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19607.47 Da Isoelectric Point: 6.6343
>T249791 WP_000342455.1 NZ_CP099895:297417-297944 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|