Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 91932..92730 | Replicon | plasmid plas1 |
Accession | NZ_CP099893 | ||
Organism | Escherichia albertii strain 155_2_TBG_A |
Toxin (Protein)
Gene name | ataT | Uniprot ID | E2QDF3 |
Locus tag | NIZ16_RS23465 | Protein ID | WP_000072677.1 |
Coordinates | 92209..92730 (+) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
Locus tag | NIZ16_RS23460 | Protein ID | WP_001351987.1 |
Coordinates | 91932..92201 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ16_RS23435 (NIZ16_23420) | 87359..88699 | - | 1341 | WP_000137333.1 | DnaB-like helicase C-terminal domain-containing protein | - |
NIZ16_RS23440 (NIZ16_23425) | 88743..89483 | - | 741 | WP_187192596.1 | hypothetical protein | - |
NIZ16_RS23445 (NIZ16_23430) | 89766..90533 | + | 768 | WP_000342417.1 | hypothetical protein | - |
NIZ16_RS23450 (NIZ16_23435) | 90586..90939 | - | 354 | WP_160378290.1 | hypothetical protein | - |
NIZ16_RS23455 (NIZ16_23440) | 90945..91613 | - | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
NIZ16_RS23460 (NIZ16_23445) | 91932..92201 | + | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
NIZ16_RS23465 (NIZ16_23450) | 92209..92730 | + | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
NIZ16_RS23470 (NIZ16_23455) | 92899..93150 | - | 252 | WP_000901559.1 | hypothetical protein | - |
NIZ16_RS23475 (NIZ16_23460) | 93152..93844 | - | 693 | WP_012640731.1 | hypothetical protein | - |
NIZ16_RS23480 (NIZ16_23465) | 93858..94181 | - | 324 | WP_000064175.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..126289 | 126289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T249787 WP_000072677.1 NZ_CP099893:92209-92730 [Escherichia albertii]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6P3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6Q7 |