Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3481950..3482568 | Replicon | chromosome |
Accession | NZ_CP099892 | ||
Organism | Escherichia albertii strain 155_2_TBG_A |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NIZ16_RS17065 | Protein ID | WP_001280991.1 |
Coordinates | 3482350..3482568 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NIZ16_RS17060 | Protein ID | WP_256878553.1 |
Coordinates | 3481950..3482324 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ16_RS17050 (3477030) | 3477030..3478223 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NIZ16_RS17055 (3478246) | 3478246..3481395 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
NIZ16_RS17060 (3481950) | 3481950..3482324 | + | 375 | WP_256878553.1 | Hha toxicity modulator TomB | Antitoxin |
NIZ16_RS17065 (3482350) | 3482350..3482568 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NIZ16_RS17070 (3482745) | 3482745..3483302 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
NIZ16_RS17075 (3483409) | 3483409..3483879 | + | 471 | WP_000136188.1 | YlaC family protein | - |
NIZ16_RS17080 (3484043) | 3484043..3485592 | + | 1550 | Protein_3333 | EAL domain-containing protein | - |
NIZ16_RS17085 (3485630) | 3485630..3485983 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
NIZ16_RS17095 (3486364) | 3486364..3486675 | + | 312 | WP_000409915.1 | MGMT family protein | - |
NIZ16_RS17100 (3486705) | 3486705..3487277 | - | 573 | WP_256875765.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249779 WP_001280991.1 NZ_CP099892:3482350-3482568 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14455.34 Da Isoelectric Point: 5.1542
>AT249779 WP_256878553.1 NZ_CP099892:3481950-3482324 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|