Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 8549..9192 Replicon plasmid plas1
Accession NZ_CP099891
Organism Escherichia albertii strain 205_2_TBG_B

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag NIZ17_RS23655 Protein ID WP_256876211.1
Coordinates 8776..9192 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag NIZ17_RS23650 Protein ID WP_256876210.1
Coordinates 8549..8779 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ17_RS23620 (NIZ17_23600) 3832..4803 - 972 WP_256880767.1 plasmid segregation protein ParM -
NIZ17_RS23625 (NIZ17_23605) 5032..5676 + 645 WP_256880768.1 AAA family ATPase -
NIZ17_RS23630 (NIZ17_23610) 5670..5945 + 276 WP_256880769.1 CopG family transcriptional regulator -
NIZ17_RS23635 (NIZ17_23615) 6084..6866 - 783 WP_256880770.1 site-specific integrase -
NIZ17_RS23640 (NIZ17_23620) 6879..7589 - 711 WP_256880771.1 hypothetical protein -
NIZ17_RS23645 (NIZ17_23625) 7629..7979 - 351 WP_256880772.1 hypothetical protein -
NIZ17_RS23650 (NIZ17_23630) 8549..8779 + 231 WP_256876210.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIZ17_RS23655 (NIZ17_23635) 8776..9192 + 417 WP_256876211.1 type II toxin-antitoxin system VapC family toxin Toxin
NIZ17_RS23660 (NIZ17_23640) 9332..10312 + 981 WP_256876212.1 hypothetical protein -
NIZ17_RS23665 (NIZ17_23645) 10520..11677 - 1158 WP_256880773.1 AAA family ATPase -
NIZ17_RS23670 (NIZ17_23650) 11737..12905 + 1169 WP_256880774.1 IS3-like element IS911 family transposase -
NIZ17_RS23675 (NIZ17_23655) 12840..13343 - 504 WP_256880775.1 ATP-binding protein -
NIZ17_RS23680 (NIZ17_23660) 13662..13931 + 270 WP_000343793.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 / espL2 1..46615 46615


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-49)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15080.41 Da        Isoelectric Point: 6.7125

>T249764 WP_256876211.1 NZ_CP099891:8776-9192 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8678.80 Da        Isoelectric Point: 4.6017

>AT249764 WP_256876210.1 NZ_CP099891:8549-8779 [Escherichia albertii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGGSIILRPVRPTWGSFAQLEKADPDFMAEREDVISDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References