Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 1636765..1637357 | Replicon | chromosome |
Accession | NZ_CP099890 | ||
Organism | Escherichia albertii strain 205_2_TBG_B |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NIZ17_RS08190 | Protein ID | WP_256880610.1 |
Coordinates | 1636765..1637139 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NIZ17_RS08195 | Protein ID | WP_171002579.1 |
Coordinates | 1637139..1637357 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ17_RS08175 (1634268) | 1634268..1635170 | + | 903 | WP_000331387.1 | formate dehydrogenase O subunit beta | - |
NIZ17_RS08180 (1635167) | 1635167..1635802 | + | 636 | WP_059277370.1 | formate dehydrogenase cytochrome b556 subunit | - |
NIZ17_RS08185 (1635799) | 1635799..1636728 | + | 930 | WP_000027704.1 | formate dehydrogenase accessory protein FdhE | - |
NIZ17_RS08190 (1636765) | 1636765..1637139 | - | 375 | WP_256880610.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIZ17_RS08195 (1637139) | 1637139..1637357 | - | 219 | WP_171002579.1 | CopG family transcriptional regulator | Antitoxin |
NIZ17_RS08200 (1637778) | 1637778..1638056 | - | 279 | WP_000102977.1 | hypothetical protein | - |
NIZ17_RS08205 (1638108) | 1638108..1638329 | - | 222 | WP_256880611.1 | cobalt ABC transporter ATP-binding protein | - |
NIZ17_RS08210 (1638414) | 1638414..1638704 | - | 291 | WP_000356397.1 | NadS family protein | - |
NIZ17_RS08215 (1638705) | 1638705..1639016 | - | 312 | WP_000897302.1 | hypothetical protein | - |
NIZ17_RS08220 (1639245) | 1639245..1640153 | + | 909 | WP_256880612.1 | alpha/beta hydrolase | - |
NIZ17_RS08225 (1640217) | 1640217..1641158 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NIZ17_RS08230 (1641203) | 1641203..1641640 | - | 438 | WP_000560977.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13928.15 Da Isoelectric Point: 8.4539
>T249751 WP_256880610.1 NZ_CP099890:c1637139-1636765 [Escherichia albertii]
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYNQEHRTQIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYNQEHRTQIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|