Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 1196552..1197147 | Replicon | chromosome |
| Accession | NZ_CP099890 | ||
| Organism | Escherichia albertii strain 205_2_TBG_B | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | NIZ17_RS06035 | Protein ID | WP_059255551.1 |
| Coordinates | 1196552..1196902 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | - |
| Locus tag | NIZ17_RS06040 | Protein ID | WP_059255553.1 |
| Coordinates | 1196896..1197147 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ17_RS06015 (1192158) | 1192158..1192979 | + | 822 | WP_256880538.1 | PfkB family carbohydrate kinase | - |
| NIZ17_RS06020 (1193139) | 1193139..1194521 | + | 1383 | WP_256880539.1 | sugar porter family MFS transporter | - |
| NIZ17_RS06025 (1194607) | 1194607..1195107 | + | 501 | WP_059255546.1 | D-ribose pyranase | - |
| NIZ17_RS06030 (1195120) | 1195120..1196499 | + | 1380 | WP_085455823.1 | sugar porter family MFS transporter | - |
| NIZ17_RS06035 (1196552) | 1196552..1196902 | - | 351 | WP_059255551.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| NIZ17_RS06040 (1196896) | 1196896..1197147 | - | 252 | WP_059255553.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NIZ17_RS06045 (1197356) | 1197356..1197700 | - | 345 | WP_001219163.1 | gamma-glutamylcyclotransferase | - |
| NIZ17_RS06050 (1197703) | 1197703..1201482 | - | 3780 | WP_256880540.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12631.65 Da Isoelectric Point: 5.1420
>T249750 WP_059255551.1 NZ_CP099890:c1196902-1196552 [Escherichia albertii]
MVKRSEFERGDIMLVGFDPASGHEQRGAGRPVLVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLRCEEGDVCGVVVV
NQVRMMDLNARQAKRIGLACDEVVEEVLLRLQAVVE
MVKRSEFERGDIMLVGFDPASGHEQRGAGRPVLVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLRCEEGDVCGVVVV
NQVRMMDLNARQAKRIGLACDEVVEEVLLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|