Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 502985..503603 | Replicon | chromosome |
| Accession | NZ_CP099890 | ||
| Organism | Escherichia albertii strain 205_2_TBG_B | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIZ17_RS02475 | Protein ID | WP_001280991.1 |
| Coordinates | 503385..503603 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | NIZ17_RS02470 | Protein ID | WP_000344798.1 |
| Coordinates | 502985..503359 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ17_RS02460 (498065) | 498065..499258 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIZ17_RS02465 (499281) | 499281..502430 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIZ17_RS02470 (502985) | 502985..503359 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| NIZ17_RS02475 (503385) | 503385..503603 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIZ17_RS02480 (503780) | 503780..504337 | + | 558 | WP_000093561.1 | maltose O-acetyltransferase | - |
| NIZ17_RS02485 (504445) | 504445..504915 | + | 471 | WP_256880386.1 | YlaC family protein | - |
| NIZ17_RS02490 (505079) | 505079..506629 | + | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| NIZ17_RS02495 (506718) | 506718..507886 | + | 1169 | WP_102203946.1 | IS3-like element IS911 family transposase | - |
| NIZ17_RS02500 (507895) | 507895..508161 | - | 267 | Protein_481 | DUF1428 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249747 WP_001280991.1 NZ_CP099890:503385-503603 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249747 WP_000344798.1 NZ_CP099890:502985-503359 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|