Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 41909..42444 Replicon plasmid plas2
Accession NZ_CP099889
Organism Escherichia albertii strain 208_2_GWG_B

Toxin (Protein)


Gene name relE Uniprot ID T2HS21
Locus tag NIZ18_RS23780 Protein ID WP_000222775.1
Coordinates 42157..42444 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID T2HSA2
Locus tag NIZ18_RS23775 Protein ID WP_001139207.1
Coordinates 41909..42160 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ18_RS23735 (NIZ18_23720) 37016..37234 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA -
NIZ18_RS23740 (NIZ18_23725) 37236..37541 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NIZ18_RS23745 (NIZ18_23730) 37542..38350 + 809 Protein_46 site-specific integrase -
NIZ18_RS23750 (NIZ18_23735) 38530..39174 + 645 WP_001144036.1 ParA family protein -
NIZ18_RS23755 (NIZ18_23740) 39261..39569 + 309 WP_000030204.1 molecular chaperone GroEL -
NIZ18_RS23760 (NIZ18_23745) 39981..40961 + 981 WP_256875926.1 plasmid segregation protein ParM -
NIZ18_RS23765 (NIZ18_23750) 40954..41370 + 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ18_RS23770 (NIZ18_23755) 41372..41794 - 423 Protein_51 DUF4113 domain-containing protein -
NIZ18_RS23775 (NIZ18_23760) 41909..42160 + 252 WP_001139207.1 plasmid stabilization protein Antitoxin
NIZ18_RS23780 (NIZ18_23765) 42157..42444 + 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIZ18_RS23785 (NIZ18_23770) 42454..42825 + 372 WP_256875924.1 hypothetical protein -
NIZ18_RS23790 (NIZ18_23775) 43726..44312 + 587 Protein_55 serine acetyltransferase -
NIZ18_RS23795 (NIZ18_23780) 44592..45185 - 594 WP_001523457.1 ProQ/FINO family protein -
NIZ18_RS23800 (NIZ18_23785) 46188..46952 + 765 WP_256875923.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 / faeH / faeI 1..79688 79688


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11142.17 Da        Isoelectric Point: 10.6261

>T249746 WP_000222775.1 NZ_CP099889:42157-42444 [Escherichia albertii]
MTYTVKFRDDALREWLKLDKSVQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSHVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9216.45 Da        Isoelectric Point: 4.0927

>AT249746 WP_001139207.1 NZ_CP099889:41909-42160 [Escherichia albertii]
MPSIILSDTSASVSELKKNPMATVSAGEGYPVAILNRNQPAFYCVPAELYERMLDAMDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB T2HS21

Antitoxin

Source ID Structure
AlphaFold DB A0A754EQ65

References