Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 37016..37541 Replicon plasmid plas2
Accession NZ_CP099889
Organism Escherichia albertii strain 208_2_GWG_B

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NIZ18_RS23740 Protein ID WP_001159871.1
Coordinates 37236..37541 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag NIZ18_RS23735 Protein ID WP_000813639.1
Coordinates 37016..37234 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ18_RS23700 (NIZ18_23685) 32580..34172 - 1593 WP_256878671.1 IS66 family transposase -
NIZ18_RS23705 (NIZ18_23690) 34203..34553 - 351 WP_000624718.1 IS66 family insertion sequence element accessory protein TnpB -
NIZ18_RS23710 (NIZ18_23695) 34550..34969 - 420 WP_065106474.1 transposase -
NIZ18_RS23715 (NIZ18_23700) 35056..35241 + 186 Protein_40 transposase -
NIZ18_RS23720 (NIZ18_23705) 35237..35506 - 270 Protein_41 tyrosine-type recombinase/integrase -
NIZ18_RS23725 (NIZ18_23710) 35566..36162 - 597 WP_059217960.1 hypothetical protein -
NIZ18_RS23730 (NIZ18_23715) 36150..36419 - 270 WP_000343793.1 hypothetical protein -
NIZ18_RS23735 (NIZ18_23720) 37016..37234 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIZ18_RS23740 (NIZ18_23725) 37236..37541 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NIZ18_RS23745 (NIZ18_23730) 37542..38350 + 809 Protein_46 site-specific integrase -
NIZ18_RS23750 (NIZ18_23735) 38530..39174 + 645 WP_001144036.1 ParA family protein -
NIZ18_RS23755 (NIZ18_23740) 39261..39569 + 309 WP_000030204.1 molecular chaperone GroEL -
NIZ18_RS23760 (NIZ18_23745) 39981..40961 + 981 WP_256875926.1 plasmid segregation protein ParM -
NIZ18_RS23765 (NIZ18_23750) 40954..41370 + 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ18_RS23770 (NIZ18_23755) 41372..41794 - 423 Protein_51 DUF4113 domain-containing protein -
NIZ18_RS23775 (NIZ18_23760) 41909..42160 + 252 WP_001139207.1 plasmid stabilization protein -
NIZ18_RS23780 (NIZ18_23765) 42157..42444 + 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 / faeH / faeI 1..79688 79688


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T249745 WP_001159871.1 NZ_CP099889:37236-37541 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT249745 WP_000813639.1 NZ_CP099889:37016-37234 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References