Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3482241..3482859 | Replicon | chromosome |
Accession | NZ_CP099887 | ||
Organism | Escherichia albertii strain 208_2_GWG_B |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NIZ18_RS17060 | Protein ID | WP_001280991.1 |
Coordinates | 3482641..3482859 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NIZ18_RS17055 | Protein ID | WP_256878553.1 |
Coordinates | 3482241..3482615 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ18_RS17045 (3477321) | 3477321..3478514 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NIZ18_RS17050 (3478537) | 3478537..3481686 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
NIZ18_RS17055 (3482241) | 3482241..3482615 | + | 375 | WP_256878553.1 | Hha toxicity modulator TomB | Antitoxin |
NIZ18_RS17060 (3482641) | 3482641..3482859 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NIZ18_RS17065 (3483036) | 3483036..3483593 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
NIZ18_RS17070 (3483700) | 3483700..3484170 | + | 471 | WP_000136188.1 | YlaC family protein | - |
NIZ18_RS17075 (3484334) | 3484334..3485883 | + | 1550 | Protein_3342 | EAL domain-containing protein | - |
NIZ18_RS17080 (3485921) | 3485921..3486274 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
NIZ18_RS17090 (3486655) | 3486655..3486966 | + | 312 | WP_000409915.1 | MGMT family protein | - |
NIZ18_RS17095 (3486996) | 3486996..3487568 | - | 573 | WP_256875765.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249736 WP_001280991.1 NZ_CP099887:3482641-3482859 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14455.34 Da Isoelectric Point: 5.1542
>AT249736 WP_256878553.1 NZ_CP099887:3482241-3482615 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|