Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 2416706..2417310 | Replicon | chromosome |
Accession | NZ_CP099887 | ||
Organism | Escherichia albertii strain 208_2_GWG_B |
Toxin (Protein)
Gene name | doc | Uniprot ID | B1EM00 |
Locus tag | NIZ18_RS11865 | Protein ID | WP_000638401.1 |
Coordinates | 2416924..2417310 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | B1ELZ9 |
Locus tag | NIZ18_RS11860 | Protein ID | WP_001195490.1 |
Coordinates | 2416706..2416927 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ18_RS11845 (2412945) | 2412945..2414396 | + | 1452 | WP_000854601.1 | tagaturonate reductase | - |
NIZ18_RS11850 (2414601) | 2414601..2415515 | + | 915 | WP_059241669.1 | bestrophin family protein | - |
NIZ18_RS11855 (2415519) | 2415519..2416277 | - | 759 | WP_059236621.1 | trans-aconitate 2-methyltransferase | - |
NIZ18_RS11860 (2416706) | 2416706..2416927 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NIZ18_RS11865 (2416924) | 2416924..2417310 | + | 387 | WP_000638401.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14505.49 Da Isoelectric Point: 8.0833
>T249734 WP_000638401.1 NZ_CP099887:2416924-2417310 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T5VDW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6PD20 |