Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 142033..142645 | Replicon | chromosome |
| Accession | NZ_CP099887 | ||
| Organism | Escherichia albertii strain 208_2_GWG_B | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | NIZ18_RS00620 | Protein ID | WP_000833473.1 |
| Coordinates | 142033..142218 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NIZ18_RS00625 | Protein ID | WP_059235556.1 |
| Coordinates | 142235..142645 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ18_RS00605 (137497) | 137497..138792 | + | 1296 | WP_059235552.1 | Fic family protein | - |
| NIZ18_RS00610 (138900) | 138900..140438 | + | 1539 | WP_002460288.1 | aldehyde dehydrogenase AldB | - |
| NIZ18_RS00615 (140479) | 140479..141558 | - | 1080 | WP_025238097.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| NIZ18_RS00620 (142033) | 142033..142218 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIZ18_RS00625 (142235) | 142235..142645 | + | 411 | WP_059235556.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIZ18_RS00630 (142717) | 142717..144681 | - | 1965 | WP_256875795.1 | glycoside hydrolase family 127 protein | - |
| NIZ18_RS00635 (144692) | 144692..146092 | - | 1401 | WP_025238099.1 | MFS transporter | - |
| NIZ18_RS00640 (146318) | 146318..147133 | + | 816 | WP_059242247.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T249722 WP_000833473.1 NZ_CP099887:142033-142218 [Escherichia albertii]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15193.10 Da Isoelectric Point: 4.5486
>AT249722 WP_059235556.1 NZ_CP099887:142235-142645 [Escherichia albertii]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQVEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQVEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|