Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4823915..4824449 | Replicon | chromosome |
| Accession | NZ_CP099886 | ||
| Organism | Escherichia albertii strain 222_1_EW_B | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NIZ19_RS23680 | Protein ID | WP_256877300.1 |
| Coordinates | 4824159..4824449 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NIZ19_RS23675 | Protein ID | WP_099588231.1 |
| Coordinates | 4823915..4824169 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ19_RS23635 (4819259) | 4819259..4819819 | + | 561 | WP_001587438.1 | fertility inhibition protein FinO | - |
| NIZ19_RS23640 (4819955) | 4819955..4820167 | + | 213 | WP_256877299.1 | hypothetical protein | - |
| NIZ19_RS23645 (4820454) | 4820454..4820633 | + | 180 | Protein_4599 | thermonuclease family protein | - |
| NIZ19_RS23650 (4820630) | 4820630..4820863 | + | 234 | Protein_4600 | DUF2726 domain-containing protein | - |
| - (4821040) | 4821040..4821101 | - | 62 | NuclAT_8 | - | - |
| - (4821040) | 4821040..4821101 | - | 62 | NuclAT_8 | - | - |
| - (4821040) | 4821040..4821101 | - | 62 | NuclAT_8 | - | - |
| - (4821040) | 4821040..4821101 | - | 62 | NuclAT_8 | - | - |
| NIZ19_RS23655 (4821145) | 4821145..4821294 | + | 150 | WP_001312851.1 | Hok/Gef family protein | - |
| NIZ19_RS23660 (4821578) | 4821578..4821826 | + | 249 | WP_099588233.1 | replication regulatory protein RepA | - |
| NIZ19_RS23665 (4822072) | 4822072..4822146 | + | 75 | WP_032144212.1 | RepA leader peptide Tap | - |
| NIZ19_RS23670 (4822139) | 4822139..4822996 | + | 858 | WP_157760420.1 | incFII family plasmid replication initiator RepA | - |
| NIZ19_RS23675 (4823915) | 4823915..4824169 | + | 255 | WP_099588231.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NIZ19_RS23680 (4824159) | 4824159..4824449 | + | 291 | WP_256877300.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIZ19_RS23685 (4824612) | 4824612..4824772 | + | 161 | Protein_4607 | IS256 family transposase | - |
| NIZ19_RS23690 (4824854) | 4824854..4825354 | + | 501 | WP_157760419.1 | GNAT family N-acetyltransferase | - |
| NIZ19_RS23695 (4826507) | 4826507..4828975 | + | 2469 | Protein_4609 | ESPR-type extended signal peptide-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | vat / papC / papD | 4821578..4873529 | 51951 | |
| - | inside | Genomic island | - | vat / papC / papD | 4821578..4873921 | 52343 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11392.31 Da Isoelectric Point: 10.5066
>T249720 WP_256877300.1 NZ_CP099886:4824159-4824449 [Escherichia albertii]
MTFNIDFDERAFKEWKTLDKTIRDQFKKKLRKLQHNPYTGAARLHGDLAGCFKIKLRASGYRLIYKVIDEEIVIWVIAVG
KRERSNVYNIASERMK
MTFNIDFDERAFKEWKTLDKTIRDQFKKKLRKLQHNPYTGAARLHGDLAGCFKIKLRASGYRLIYKVIDEEIVIWVIAVG
KRERSNVYNIASERMK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|