Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 4553625..4554103 Replicon chromosome
Accession NZ_CP099886
Organism Escherichia albertii strain 222_1_EW_B

Toxin (Protein)


Gene name parE_1 Uniprot ID -
Locus tag NIZ19_RS22390 Protein ID WP_256877240.1
Coordinates 4553816..4554103 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID -
Locus tag NIZ19_RS22385 Protein ID WP_256877239.1
Coordinates 4553625..4553816 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ19_RS22340 (4548869) 4548869..4549087 - 219 WP_000209148.1 DUF4014 family protein -
NIZ19_RS22345 (4549120) 4549120..4549332 - 213 WP_000935424.1 hypothetical protein -
NIZ19_RS22350 (4549438) 4549438..4549860 - 423 WP_001151239.1 DUF977 family protein -
NIZ19_RS22355 (4549876) 4549876..4550646 - 771 WP_000450998.1 DUF1627 domain-containing protein -
NIZ19_RS22360 (4550668) 4550668..4551414 - 747 WP_000788950.1 ATP-binding protein -
NIZ19_RS22365 (4551421) 4551421..4552383 - 963 WP_000095673.1 helix-turn-helix domain-containing protein -
NIZ19_RS22370 (4552406) 4552406..4552831 - 426 WP_256877238.1 toxin YdaT family protein -
NIZ19_RS22375 (4552815) 4552815..4553087 - 273 WP_069722730.1 YdaS family helix-turn-helix protein -
NIZ19_RS22380 (4553196) 4553196..4553597 + 402 WP_062898147.1 helix-turn-helix domain-containing protein -
NIZ19_RS22385 (4553625) 4553625..4553816 + 192 WP_256877239.1 antitoxin Antitoxin
NIZ19_RS22390 (4553816) 4553816..4554103 + 288 WP_256877240.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIZ19_RS22395 (4554442) 4554442..4554741 + 300 WP_256877702.1 hypothetical protein -
NIZ19_RS22400 (4554813) 4554813..4554929 + 117 Protein_4351 hypothetical protein -
NIZ19_RS22405 (4554984) 4554984..4556197 + 1214 WP_162830753.1 IS3 family transposase -
NIZ19_RS22410 (4556237) 4556237..4556344 + 108 Protein_4353 hypothetical protein -
NIZ19_RS22415 (4556367) 4556367..4556774 + 408 WP_000394520.1 hypothetical protein -
NIZ19_RS22420 (4556752) 4556752..4556985 - 234 WP_000920491.1 hypothetical protein -
NIZ19_RS22425 (4557546) 4557546..4557734 + 189 WP_000449200.1 cell division inhibition protein DicB -
NIZ19_RS22430 (4557731) 4557731..4557934 + 204 WP_059215638.1 DUF1482 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4519782..4564182 44400
- inside Prophage - ompA 4519782..4588530 68748


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10980.85 Da        Isoelectric Point: 10.1360

>T249715 WP_256877240.1 NZ_CP099886:4553816-4554103 [Escherichia albertii]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVATSSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7083.84 Da        Isoelectric Point: 4.0270

>AT249715 WP_256877239.1 NZ_CP099886:4553625-4553816 [Escherichia albertii]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMTEMENLIAQIAVTNRSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References