Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 4553625..4554103 | Replicon | chromosome |
| Accession | NZ_CP099886 | ||
| Organism | Escherichia albertii strain 222_1_EW_B | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | - |
| Locus tag | NIZ19_RS22390 | Protein ID | WP_256877240.1 |
| Coordinates | 4553816..4554103 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | - |
| Locus tag | NIZ19_RS22385 | Protein ID | WP_256877239.1 |
| Coordinates | 4553625..4553816 (+) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ19_RS22340 (4548869) | 4548869..4549087 | - | 219 | WP_000209148.1 | DUF4014 family protein | - |
| NIZ19_RS22345 (4549120) | 4549120..4549332 | - | 213 | WP_000935424.1 | hypothetical protein | - |
| NIZ19_RS22350 (4549438) | 4549438..4549860 | - | 423 | WP_001151239.1 | DUF977 family protein | - |
| NIZ19_RS22355 (4549876) | 4549876..4550646 | - | 771 | WP_000450998.1 | DUF1627 domain-containing protein | - |
| NIZ19_RS22360 (4550668) | 4550668..4551414 | - | 747 | WP_000788950.1 | ATP-binding protein | - |
| NIZ19_RS22365 (4551421) | 4551421..4552383 | - | 963 | WP_000095673.1 | helix-turn-helix domain-containing protein | - |
| NIZ19_RS22370 (4552406) | 4552406..4552831 | - | 426 | WP_256877238.1 | toxin YdaT family protein | - |
| NIZ19_RS22375 (4552815) | 4552815..4553087 | - | 273 | WP_069722730.1 | YdaS family helix-turn-helix protein | - |
| NIZ19_RS22380 (4553196) | 4553196..4553597 | + | 402 | WP_062898147.1 | helix-turn-helix domain-containing protein | - |
| NIZ19_RS22385 (4553625) | 4553625..4553816 | + | 192 | WP_256877239.1 | antitoxin | Antitoxin |
| NIZ19_RS22390 (4553816) | 4553816..4554103 | + | 288 | WP_256877240.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIZ19_RS22395 (4554442) | 4554442..4554741 | + | 300 | WP_256877702.1 | hypothetical protein | - |
| NIZ19_RS22400 (4554813) | 4554813..4554929 | + | 117 | Protein_4351 | hypothetical protein | - |
| NIZ19_RS22405 (4554984) | 4554984..4556197 | + | 1214 | WP_162830753.1 | IS3 family transposase | - |
| NIZ19_RS22410 (4556237) | 4556237..4556344 | + | 108 | Protein_4353 | hypothetical protein | - |
| NIZ19_RS22415 (4556367) | 4556367..4556774 | + | 408 | WP_000394520.1 | hypothetical protein | - |
| NIZ19_RS22420 (4556752) | 4556752..4556985 | - | 234 | WP_000920491.1 | hypothetical protein | - |
| NIZ19_RS22425 (4557546) | 4557546..4557734 | + | 189 | WP_000449200.1 | cell division inhibition protein DicB | - |
| NIZ19_RS22430 (4557731) | 4557731..4557934 | + | 204 | WP_059215638.1 | DUF1482 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4519782..4564182 | 44400 | |
| - | inside | Prophage | - | ompA | 4519782..4588530 | 68748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10980.85 Da Isoelectric Point: 10.1360
>T249715 WP_256877240.1 NZ_CP099886:4553816-4554103 [Escherichia albertii]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVATSSIE
IVSVTHSRRQFPFSI
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVATSSIE
IVSVTHSRRQFPFSI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|