Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3164250..3164868 | Replicon | chromosome |
| Accession | NZ_CP099886 | ||
| Organism | Escherichia albertii strain 222_1_EW_B | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIZ19_RS15280 | Protein ID | WP_001280991.1 |
| Coordinates | 3164250..3164468 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | NIZ19_RS15285 | Protein ID | WP_000344798.1 |
| Coordinates | 3164494..3164868 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ19_RS15245 (3159539) | 3159539..3160111 | + | 573 | WP_256876988.1 | YbaY family lipoprotein | - |
| NIZ19_RS15250 (3160141) | 3160141..3160452 | - | 312 | WP_000409915.1 | MGMT family protein | - |
| NIZ19_RS15260 (3160833) | 3160833..3161186 | + | 354 | WP_000878151.1 | DUF1428 family protein | - |
| NIZ19_RS15265 (3161224) | 3161224..3162774 | - | 1551 | WP_099587736.1 | EAL domain-containing protein | - |
| NIZ19_RS15270 (3162938) | 3162938..3163408 | - | 471 | WP_000136187.1 | YlaC family protein | - |
| NIZ19_RS15275 (3163516) | 3163516..3164073 | - | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| NIZ19_RS15280 (3164250) | 3164250..3164468 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIZ19_RS15285 (3164494) | 3164494..3164868 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| NIZ19_RS15290 (3165423) | 3165423..3168572 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIZ19_RS15295 (3168595) | 3168595..3169788 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249704 WP_001280991.1 NZ_CP099886:c3164468-3164250 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249704 WP_000344798.1 NZ_CP099886:c3164868-3164494 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|