Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 2468271..2468866 | Replicon | chromosome |
| Accession | NZ_CP099886 | ||
| Organism | Escherichia albertii strain 222_1_EW_B | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | NIZ19_RS12015 | Protein ID | WP_059255551.1 |
| Coordinates | 2468516..2468866 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | - |
| Locus tag | NIZ19_RS12010 | Protein ID | WP_059255553.1 |
| Coordinates | 2468271..2468522 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ19_RS12000 (2463936) | 2463936..2467715 | + | 3780 | WP_256876889.1 | autotransporter assembly complex protein TamB | - |
| NIZ19_RS12005 (2467718) | 2467718..2468062 | + | 345 | WP_001219163.1 | gamma-glutamylcyclotransferase | - |
| NIZ19_RS12010 (2468271) | 2468271..2468522 | + | 252 | WP_059255553.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NIZ19_RS12015 (2468516) | 2468516..2468866 | + | 351 | WP_059255551.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| NIZ19_RS12020 (2468919) | 2468919..2470298 | - | 1380 | WP_256876890.1 | sugar porter family MFS transporter | - |
| NIZ19_RS12025 (2470311) | 2470311..2470811 | - | 501 | WP_256876891.1 | D-ribose pyranase | - |
| NIZ19_RS12030 (2470897) | 2470897..2472279 | - | 1383 | WP_256876892.1 | sugar porter family MFS transporter | - |
| NIZ19_RS12035 (2472293) | 2472293..2473261 | - | 969 | WP_256876893.1 | PfkB family carbohydrate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12631.65 Da Isoelectric Point: 5.1420
>T249697 WP_059255551.1 NZ_CP099886:2468516-2468866 [Escherichia albertii]
MVKRSEFERGDIMLVGFDPASGHEQRGAGRPVLVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLRCEEGDVCGVVVV
NQVRMMDLNARQAKRIGLACDEVVEEVLLRLQAVVE
MVKRSEFERGDIMLVGFDPASGHEQRGAGRPVLVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLRCEEGDVCGVVVV
NQVRMMDLNARQAKRIGLACDEVVEEVLLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|