Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2068975..2069591 | Replicon | chromosome |
| Accession | NZ_CP099886 | ||
| Organism | Escherichia albertii strain 222_1_EW_B | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NIZ19_RS10135 | Protein ID | WP_107192776.1 |
| Coordinates | 2069217..2069591 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NIZ19_RS10130 | Protein ID | WP_103054107.1 |
| Coordinates | 2068975..2069217 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ19_RS10090 (2064267) | 2064267..2064704 | + | 438 | WP_000560977.1 | D-aminoacyl-tRNA deacylase | - |
| NIZ19_RS10095 (2064749) | 2064749..2065690 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NIZ19_RS10100 (2065754) | 2065754..2066662 | - | 909 | WP_059239594.1 | alpha/beta hydrolase | - |
| NIZ19_RS10105 (2066891) | 2066891..2067202 | + | 312 | WP_000897302.1 | hypothetical protein | - |
| NIZ19_RS10110 (2067203) | 2067203..2067493 | + | 291 | WP_000356397.1 | NadS family protein | - |
| NIZ19_RS10115 (2067578) | 2067578..2067790 | + | 213 | WP_000197774.1 | hypothetical protein | - |
| NIZ19_RS10120 (2067852) | 2067852..2068130 | + | 279 | WP_032278934.1 | hypothetical protein | - |
| NIZ19_RS10125 (2068529) | 2068529..2068747 | + | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| NIZ19_RS10130 (2068975) | 2068975..2069217 | + | 243 | WP_103054107.1 | CopG family transcriptional regulator | Antitoxin |
| NIZ19_RS10135 (2069217) | 2069217..2069591 | + | 375 | WP_107192776.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIZ19_RS10140 (2069628) | 2069628..2070557 | - | 930 | WP_000027704.1 | formate dehydrogenase accessory protein FdhE | - |
| NIZ19_RS10145 (2070554) | 2070554..2071189 | - | 636 | WP_000829019.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NIZ19_RS10150 (2071186) | 2071186..2072088 | - | 903 | WP_000331386.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13944.15 Da Isoelectric Point: 8.4539
>T249696 WP_107192776.1 NZ_CP099886:2069217-2069591 [Escherichia albertii]
MAKRTALFDTNILIDLFSGRIESKQALEAWPLQNAISLVTWMEVLVGAKKYNQEHRTQIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP
MAKRTALFDTNILIDLFSGRIESKQALEAWPLQNAISLVTWMEVLVGAKKYNQEHRTQIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|