Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1798656..1799307 | Replicon | chromosome |
| Accession | NZ_CP099886 | ||
| Organism | Escherichia albertii strain 222_1_EW_B | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NIZ19_RS08840 | Protein ID | WP_161537425.1 |
| Coordinates | 1798903..1799307 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NIZ19_RS08835 | Protein ID | WP_000354046.1 |
| Coordinates | 1798656..1798922 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ19_RS08810 (1794368) | 1794368..1795801 | - | 1434 | WP_256877592.1 | 6-phospho-beta-glucosidase BglA | - |
| NIZ19_RS08815 (1795846) | 1795846..1796157 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| NIZ19_RS08820 (1796325) | 1796325..1796984 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| NIZ19_RS08825 (1797424) | 1797424..1798404 | - | 981 | WP_256877593.1 | tRNA-modifying protein YgfZ | - |
| NIZ19_RS08830 (1798436) | 1798436..1798666 | + | 231 | WP_000181267.1 | hypothetical protein | - |
| NIZ19_RS08835 (1798656) | 1798656..1798922 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NIZ19_RS08840 (1798903) | 1798903..1799307 | + | 405 | WP_161537425.1 | protein YgfX | Toxin |
| NIZ19_RS08845 (1799346) | 1799346..1799867 | - | 522 | WP_025238422.1 | flavodoxin FldB | - |
| NIZ19_RS08850 (1799979) | 1799979..1800875 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NIZ19_RS08855 (1800900) | 1800900..1801610 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NIZ19_RS08860 (1801616) | 1801616..1803349 | + | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15819.70 Da Isoelectric Point: 10.7510
>T249694 WP_161537425.1 NZ_CP099886:1798903-1799307 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVSAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVSAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |