Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 1191174..1191974 | Replicon | chromosome |
| Accession | NZ_CP099886 | ||
| Organism | Escherichia albertii strain 222_1_EW_B | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | NIZ19_RS05840 | Protein ID | WP_256877506.1 |
| Coordinates | 1191447..1191974 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A8H9C3F4 |
| Locus tag | NIZ19_RS05835 | Protein ID | WP_001277105.1 |
| Coordinates | 1191174..1191440 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ19_RS05810 (1186895) | 1186895..1187749 | - | 855 | WP_000370583.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| NIZ19_RS05815 (1187742) | 1187742..1188488 | - | 747 | WP_256877504.1 | PTS sugar transporter subunit IIC | - |
| NIZ19_RS05820 (1188505) | 1188505..1188990 | - | 486 | WP_000029259.1 | PTS sugar transporter subunit IIB | - |
| NIZ19_RS05825 (1188997) | 1188997..1189398 | - | 402 | WP_001071334.1 | PTS sugar transporter subunit IIA | - |
| NIZ19_RS05830 (1189921) | 1189921..1191024 | + | 1104 | WP_256877505.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NIZ19_RS05835 (1191174) | 1191174..1191440 | + | 267 | WP_001277105.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NIZ19_RS05840 (1191447) | 1191447..1191974 | + | 528 | WP_256877506.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NIZ19_RS05845 (1191971) | 1191971..1192354 | - | 384 | WP_000778774.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NIZ19_RS05850 (1192778) | 1192778..1193887 | + | 1110 | WP_000827694.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NIZ19_RS05855 (1193935) | 1193935..1194861 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NIZ19_RS05860 (1194858) | 1194858..1196135 | + | 1278 | WP_256877507.1 | branched chain amino acid ABC transporter permease LivM | - |
| NIZ19_RS05865 (1196132) | 1196132..1196899 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19535.40 Da Isoelectric Point: 6.9580
>T249692 WP_256877506.1 NZ_CP099886:1191447-1191974 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVGALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVGALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|