Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 2353..2996 | Replicon | plasmid plas2 |
| Accession | NZ_CP099885 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NIZ20_RS24120 | Protein ID | WP_256876211.1 |
| Coordinates | 2353..2769 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NIZ20_RS24125 | Protein ID | WP_256876210.1 |
| Coordinates | 2766..2996 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS24110 (668) | 668..829 | + | 162 | WP_256880875.1 | hypothetical protein | - |
| NIZ20_RS24115 (1234) | 1234..2213 | - | 980 | Protein_2 | hypothetical protein | - |
| NIZ20_RS24120 (2353) | 2353..2769 | - | 417 | WP_256876211.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIZ20_RS24125 (2766) | 2766..2996 | - | 231 | WP_256876210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIZ20_RS24130 (3565) | 3565..3978 | + | 414 | WP_000465043.1 | hypothetical protein | - |
| NIZ20_RS24135 (3980) | 3980..4762 | + | 783 | WP_021533580.1 | site-specific integrase | - |
| NIZ20_RS24140 (4935) | 4935..5288 | + | 354 | WP_000864812.1 | colicin M immunity protein | - |
| NIZ20_RS24145 (5338) | 5338..6153 | - | 816 | WP_000449473.1 | lipid II-degrading bacteriocin colicin M | - |
| NIZ20_RS24150 (6396) | 6396..6923 | + | 528 | WP_000203268.1 | colicin B immunity protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 | 1..89097 | 89097 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.41 Da Isoelectric Point: 6.7125
>T249687 WP_256876211.1 NZ_CP099885:c2769-2353 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|