Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 57882..58483 | Replicon | plasmid plas1 |
| Accession | NZ_CP099884 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | NIZ20_RS23825 | Protein ID | WP_001216045.1 |
| Coordinates | 57882..58262 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NIZ20_RS23830 | Protein ID | WP_001190712.1 |
| Coordinates | 58262..58483 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS23795 (NIZ20_23770) | 53008..53238 | - | 231 | Protein_54 | ash family protein | - |
| NIZ20_RS23800 (NIZ20_23775) | 53322..54806 | - | 1485 | WP_000124159.1 | hypothetical protein | - |
| NIZ20_RS23805 (NIZ20_23780) | 54806..55999 | - | 1194 | WP_000219618.1 | hypothetical protein | - |
| NIZ20_RS23810 (NIZ20_23785) | 56086..56538 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| NIZ20_RS23815 (NIZ20_23790) | 56627..57670 | - | 1044 | WP_256876191.1 | DUF968 domain-containing protein | - |
| NIZ20_RS23820 (NIZ20_23795) | 57698..57877 | - | 180 | WP_000113019.1 | hypothetical protein | - |
| NIZ20_RS23825 (NIZ20_23800) | 57882..58262 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NIZ20_RS23830 (NIZ20_23805) | 58262..58483 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NIZ20_RS23835 (NIZ20_23810) | 58666..60222 | + | 1557 | WP_073511017.1 | type I restriction-modification system subunit M | - |
| NIZ20_RS23840 (NIZ20_23815) | 60219..61445 | + | 1227 | WP_256876192.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..110294 | 110294 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T249686 WP_001216045.1 NZ_CP099884:c58262-57882 [Escherichia albertii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |