Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2411508..2412098 | Replicon | chromosome |
| Accession | NZ_CP099883 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | NIZ20_RS11895 | Protein ID | WP_059225520.1 |
| Coordinates | 2411508..2411840 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | NIZ20_RS11900 | Protein ID | WP_059225519.1 |
| Coordinates | 2411841..2412098 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS11875 (2407212) | 2407212..2408474 | + | 1263 | WP_059225524.1 | integrase arm-type DNA-binding domain-containing protein | - |
| NIZ20_RS11880 (2409433) | 2409433..2409720 | + | 288 | WP_059225522.1 | hypothetical protein | - |
| NIZ20_RS11885 (2409816) | 2409816..2410700 | - | 885 | WP_059225521.1 | integrase domain-containing protein | - |
| NIZ20_RS11890 (2411018) | 2411018..2411395 | - | 378 | WP_161537949.1 | hypothetical protein | - |
| NIZ20_RS11895 (2411508) | 2411508..2411840 | - | 333 | WP_059225520.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NIZ20_RS11900 (2411841) | 2411841..2412098 | - | 258 | WP_059225519.1 | hypothetical protein | Antitoxin |
| NIZ20_RS11905 (2412446) | 2412446..2412651 | - | 206 | Protein_2322 | helix-turn-helix domain-containing protein | - |
| NIZ20_RS11910 (2412648) | 2412648..2413118 | - | 471 | WP_059225518.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11777.59 Da Isoelectric Point: 8.0291
>T249681 WP_059225520.1 NZ_CP099883:c2411840-2411508 [Escherichia albertii]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|