Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1949659..1950185 | Replicon | chromosome |
| Accession | NZ_CP099883 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | NIZ20_RS09395 | Protein ID | WP_000323025.1 |
| Coordinates | 1949659..1949946 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | NIZ20_RS09400 | Protein ID | WP_000534858.1 |
| Coordinates | 1949946..1950185 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS09350 (1945118) | 1945118..1945288 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| NIZ20_RS09355 (1945652) | 1945652..1945867 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| NIZ20_RS09360 (1946168) | 1946168..1946380 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| NIZ20_RS09365 (1946435) | 1946435..1946524 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| NIZ20_RS09370 (1946802) | 1946802..1947554 | - | 753 | WP_001047135.1 | antitermination protein | - |
| NIZ20_RS09375 (1947568) | 1947568..1948617 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| NIZ20_RS09380 (1948619) | 1948619..1948897 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| NIZ20_RS09385 (1948964) | 1948964..1949215 | - | 252 | WP_000980994.1 | protein Rem | - |
| NIZ20_RS09390 (1949432) | 1949432..1949587 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| NIZ20_RS09395 (1949659) | 1949659..1949946 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| NIZ20_RS09400 (1949946) | 1949946..1950185 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| NIZ20_RS09405 (1950210) | 1950210..1950515 | + | 306 | WP_071527819.1 | protein YdfV | - |
| NIZ20_RS09410 (1950718) | 1950718..1951050 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
| NIZ20_RS09415 (1951487) | 1951487..1951636 | - | 150 | WP_180302674.1 | protein YdfW | - |
| NIZ20_RS09420 (1951709) | 1951709..1952806 | - | 1098 | Protein_1837 | ISNCY family transposase | - |
| NIZ20_RS09425 (1952861) | 1952861..1953280 | - | 420 | WP_001151196.1 | DUF977 family protein | - |
| NIZ20_RS09430 (1953321) | 1953321..1954286 | - | 966 | WP_000054504.1 | hypothetical protein | - |
| NIZ20_RS09435 (1954267) | 1954267..1954788 | - | 522 | WP_000705349.1 | toxin YdaT family protein | - |
| NIZ20_RS09440 (1954772) | 1954772..1954999 | - | 228 | WP_000476993.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1911628..1973274 | 61646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T249676 WP_000323025.1 NZ_CP099883:c1949946-1949659 [Escherichia albertii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|