Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 798699..799317 | Replicon | chromosome |
| Accession | NZ_CP099883 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIZ20_RS03785 | Protein ID | WP_001280991.1 |
| Coordinates | 798699..798917 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | NIZ20_RS03790 | Protein ID | WP_000344798.1 |
| Coordinates | 798943..799317 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS03750 (793988) | 793988..794560 | + | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
| NIZ20_RS03755 (794590) | 794590..794901 | - | 312 | WP_000409915.1 | MGMT family protein | - |
| NIZ20_RS03765 (795282) | 795282..795635 | + | 354 | WP_000878151.1 | DUF1428 family protein | - |
| NIZ20_RS03770 (795673) | 795673..797223 | - | 1551 | WP_256876043.1 | EAL domain-containing protein | - |
| NIZ20_RS03775 (797387) | 797387..797857 | - | 471 | WP_059224581.1 | YlaC family protein | - |
| NIZ20_RS03780 (797965) | 797965..798522 | - | 558 | WP_000093561.1 | maltose O-acetyltransferase | - |
| NIZ20_RS03785 (798699) | 798699..798917 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIZ20_RS03790 (798943) | 798943..799317 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| NIZ20_RS03795 (799872) | 799872..803021 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIZ20_RS03800 (803044) | 803044..804237 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249671 WP_001280991.1 NZ_CP099883:c798917-798699 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249671 WP_000344798.1 NZ_CP099883:c799317-798943 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|