Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 28187..28830 | Replicon | plasmid plas2 |
Accession | NZ_CP099882 | ||
Organism | Escherichia albertii strain 233_2_GWG_B |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | NIZ21_RS24240 | Protein ID | WP_256876211.1 |
Coordinates | 28187..28603 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | NIZ21_RS24245 | Protein ID | WP_256876210.1 |
Coordinates | 28600..28830 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ21_RS24215 (23238) | 23238..23579 | - | 342 | Protein_19 | protein RepA | - |
NIZ21_RS24220 (24116) | 24116..24712 | - | 597 | WP_256876215.1 | hypothetical protein | - |
NIZ21_RS24225 (24700) | 24700..24969 | - | 270 | WP_256876214.1 | hypothetical protein | - |
NIZ21_RS24230 (25288) | 25288..26859 | + | 1572 | WP_256876213.1 | ATP-binding protein | - |
NIZ21_RS24235 (27067) | 27067..28047 | - | 981 | WP_256876212.1 | hypothetical protein | - |
NIZ21_RS24240 (28187) | 28187..28603 | - | 417 | WP_256876211.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIZ21_RS24245 (28600) | 28600..28830 | - | 231 | WP_256876210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NIZ21_RS24250 (29399) | 29399..29812 | + | 414 | WP_000465043.1 | hypothetical protein | - |
NIZ21_RS24255 (29814) | 29814..30596 | + | 783 | WP_021533580.1 | site-specific integrase | - |
NIZ21_RS24260 (30769) | 30769..31122 | + | 354 | WP_000864812.1 | colicin M immunity protein | - |
NIZ21_RS24265 (31172) | 31172..31987 | - | 816 | WP_000449473.1 | lipid II-degrading bacteriocin colicin M | - |
NIZ21_RS24270 (32230) | 32230..32757 | + | 528 | WP_000203268.1 | colicin B immunity protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | espL2 | 1..89091 | 89091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.41 Da Isoelectric Point: 6.7125
>T249661 WP_256876211.1 NZ_CP099882:c28603-28187 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|