Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 55877..56478 | Replicon | plasmid plas1 |
Accession | NZ_CP099881 | ||
Organism | Escherichia albertii strain 233_2_GWG_B |
Toxin (Protein)
Gene name | doc | Uniprot ID | U9YA20 |
Locus tag | NIZ21_RS23915 | Protein ID | WP_001216045.1 |
Coordinates | 56098..56478 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | NIZ21_RS23910 | Protein ID | WP_001190712.1 |
Coordinates | 55877..56098 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ21_RS23900 (NIZ21_23875) | 52915..54141 | - | 1227 | WP_256876192.1 | restriction endonuclease subunit S | - |
NIZ21_RS23905 (NIZ21_23880) | 54138..55694 | - | 1557 | WP_073511017.1 | type I restriction-modification system subunit M | - |
NIZ21_RS23910 (NIZ21_23885) | 55877..56098 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NIZ21_RS23915 (NIZ21_23890) | 56098..56478 | + | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NIZ21_RS23920 (NIZ21_23895) | 56483..56662 | + | 180 | WP_000113019.1 | hypothetical protein | - |
NIZ21_RS23925 (NIZ21_23900) | 56690..57733 | + | 1044 | WP_256876191.1 | DUF968 domain-containing protein | - |
NIZ21_RS23930 (NIZ21_23905) | 57822..58274 | + | 453 | WP_001326849.1 | late promoter-activating protein | - |
NIZ21_RS23935 (NIZ21_23910) | 58361..59554 | + | 1194 | WP_000219618.1 | hypothetical protein | - |
NIZ21_RS23940 (NIZ21_23915) | 59554..61038 | + | 1485 | WP_000124159.1 | hypothetical protein | - |
NIZ21_RS23945 (NIZ21_23920) | 61122..61352 | + | 231 | Protein_61 | ash family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..97175 | 97175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T249660 WP_001216045.1 NZ_CP099881:56098-56478 [Escherichia albertii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLP7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |