Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3542780..3543398 | Replicon | chromosome |
| Accession | NZ_CP099880 | ||
| Organism | Escherichia albertii strain 233_2_GWG_B | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIZ21_RS17385 | Protein ID | WP_001280991.1 |
| Coordinates | 3543180..3543398 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | NIZ21_RS17380 | Protein ID | WP_000344798.1 |
| Coordinates | 3542780..3543154 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ21_RS17370 (3537860) | 3537860..3539053 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIZ21_RS17375 (3539076) | 3539076..3542225 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIZ21_RS17380 (3542780) | 3542780..3543154 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| NIZ21_RS17385 (3543180) | 3543180..3543398 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIZ21_RS17390 (3543575) | 3543575..3544132 | + | 558 | WP_000093561.1 | maltose O-acetyltransferase | - |
| NIZ21_RS17395 (3544240) | 3544240..3544710 | + | 471 | WP_059224581.1 | YlaC family protein | - |
| NIZ21_RS17400 (3544874) | 3544874..3546424 | + | 1551 | WP_256876043.1 | EAL domain-containing protein | - |
| NIZ21_RS17405 (3546462) | 3546462..3546815 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| NIZ21_RS17415 (3547196) | 3547196..3547507 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| NIZ21_RS17420 (3547537) | 3547537..3548109 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249651 WP_001280991.1 NZ_CP099880:3543180-3543398 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249651 WP_000344798.1 NZ_CP099880:3542780-3543154 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|