Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2494062..2494666 | Replicon | chromosome |
| Accession | NZ_CP099880 | ||
| Organism | Escherichia albertii strain 233_2_GWG_B | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | NIZ21_RS12395 | Protein ID | WP_059225486.1 |
| Coordinates | 2494280..2494666 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | NIZ21_RS12390 | Protein ID | WP_001195490.1 |
| Coordinates | 2494062..2494283 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ21_RS12375 (2490312) | 2490312..2491763 | + | 1452 | WP_000854601.1 | tagaturonate reductase | - |
| NIZ21_RS12380 (2491968) | 2491968..2492882 | + | 915 | WP_024164792.1 | bestrophin family protein | - |
| NIZ21_RS12385 (2492886) | 2492886..2493644 | - | 759 | WP_233991857.1 | trans-aconitate 2-methyltransferase | - |
| NIZ21_RS12390 (2494062) | 2494062..2494283 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NIZ21_RS12395 (2494280) | 2494280..2494666 | + | 387 | WP_059225486.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14452.45 Da Isoelectric Point: 7.3228
>T249647 WP_059225486.1 NZ_CP099880:2494280-2494666 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRICDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRICDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|