Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2425751..2426277 | Replicon | chromosome |
Accession | NZ_CP099880 | ||
Organism | Escherichia albertii strain 233_2_GWG_B |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NIZ21_RS12000 | Protein ID | WP_000323025.1 |
Coordinates | 2425990..2426277 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NIZ21_RS11995 | Protein ID | WP_000534858.1 |
Coordinates | 2425751..2425990 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ21_RS11955 (2420937) | 2420937..2421164 | + | 228 | WP_000476993.1 | Cro/CI family transcriptional regulator | - |
NIZ21_RS11960 (2421148) | 2421148..2421669 | + | 522 | WP_000705349.1 | toxin YdaT family protein | - |
NIZ21_RS11965 (2421650) | 2421650..2422615 | + | 966 | WP_000054504.1 | hypothetical protein | - |
NIZ21_RS11970 (2422656) | 2422656..2423075 | + | 420 | WP_001151196.1 | DUF977 family protein | - |
NIZ21_RS11975 (2423130) | 2423130..2424179 | + | 1050 | Protein_2339 | ISNCY family transposase | - |
NIZ21_RS11980 (2424300) | 2424300..2424449 | + | 150 | WP_180302674.1 | protein YdfW | - |
NIZ21_RS11985 (2424886) | 2424886..2425218 | - | 333 | WP_001317460.1 | FlxA-like family protein | - |
NIZ21_RS11990 (2425421) | 2425421..2425726 | - | 306 | WP_071527819.1 | protein YdfV | - |
NIZ21_RS11995 (2425751) | 2425751..2425990 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NIZ21_RS12000 (2425990) | 2425990..2426277 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NIZ21_RS12005 (2426349) | 2426349..2426504 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
NIZ21_RS12010 (2426721) | 2426721..2426972 | + | 252 | WP_000980994.1 | protein Rem | - |
NIZ21_RS12015 (2427039) | 2427039..2427317 | + | 279 | WP_012304870.1 | hypothetical protein | - |
NIZ21_RS12020 (2427319) | 2427319..2428368 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
NIZ21_RS12025 (2428382) | 2428382..2429134 | + | 753 | WP_001047135.1 | antitermination protein | - |
NIZ21_RS12030 (2429412) | 2429412..2429501 | - | 90 | WP_120795389.1 | hypothetical protein | - |
NIZ21_RS12035 (2429556) | 2429556..2429768 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
NIZ21_RS12040 (2430069) | 2430069..2430284 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
NIZ21_RS12045 (2430648) | 2430648..2430818 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2402662..2464318 | 61656 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T249646 WP_000323025.1 NZ_CP099880:2425990-2426277 [Escherichia albertii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|