Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1962492..1963082 | Replicon | chromosome |
| Accession | NZ_CP099880 | ||
| Organism | Escherichia albertii strain 233_2_GWG_B | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | NIZ21_RS09495 | Protein ID | WP_059225520.1 |
| Coordinates | 1962750..1963082 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | NIZ21_RS09490 | Protein ID | WP_059225519.1 |
| Coordinates | 1962492..1962749 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ21_RS09480 (1961472) | 1961472..1961942 | + | 471 | WP_059225518.1 | hypothetical protein | - |
| NIZ21_RS09485 (1961939) | 1961939..1962144 | + | 206 | Protein_1853 | helix-turn-helix domain-containing protein | - |
| NIZ21_RS09490 (1962492) | 1962492..1962749 | + | 258 | WP_059225519.1 | hypothetical protein | Antitoxin |
| NIZ21_RS09495 (1962750) | 1962750..1963082 | + | 333 | WP_059225520.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NIZ21_RS09500 (1963195) | 1963195..1963572 | + | 378 | WP_161537949.1 | hypothetical protein | - |
| NIZ21_RS09505 (1963890) | 1963890..1964774 | + | 885 | WP_059225521.1 | integrase domain-containing protein | - |
| NIZ21_RS09510 (1964870) | 1964870..1965157 | - | 288 | WP_059225522.1 | hypothetical protein | - |
| NIZ21_RS09515 (1966116) | 1966116..1967378 | - | 1263 | WP_059225524.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11777.59 Da Isoelectric Point: 8.0291
>T249641 WP_059225520.1 NZ_CP099880:1962750-1963082 [Escherichia albertii]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|