Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 8360..8895 Replicon plasmid plas2
Accession NZ_CP099879
Organism Escherichia albertii strain 247_2_EW_B

Toxin (Protein)


Gene name relE Uniprot ID T2HS21
Locus tag NIZ22_RS23700 Protein ID WP_000222775.1
Coordinates 8608..8895 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID T2HSA2
Locus tag NIZ22_RS23695 Protein ID WP_001139207.1
Coordinates 8360..8611 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ22_RS23655 (NIZ22_23635) 3467..3685 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA -
NIZ22_RS23660 (NIZ22_23640) 3687..3992 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NIZ22_RS23665 (NIZ22_23645) 3993..4801 + 809 Protein_10 site-specific integrase -
NIZ22_RS23670 (NIZ22_23650) 4981..5625 + 645 WP_001144036.1 ParA family protein -
NIZ22_RS23675 (NIZ22_23655) 5712..6020 + 309 WP_000030204.1 molecular chaperone GroEL -
NIZ22_RS23680 (NIZ22_23660) 6432..7411 + 980 Protein_13 plasmid segregation protein ParM -
NIZ22_RS23685 (NIZ22_23665) 7404..7820 + 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ22_RS23690 (NIZ22_23670) 7822..8245 - 424 Protein_15 DUF4113 domain-containing protein -
NIZ22_RS23695 (NIZ22_23675) 8360..8611 + 252 WP_001139207.1 plasmid stabilization protein Antitoxin
NIZ22_RS23700 (NIZ22_23680) 8608..8895 + 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIZ22_RS23705 (NIZ22_23685) 8905..9276 + 372 WP_256875924.1 hypothetical protein -
NIZ22_RS23710 (NIZ22_23690) 10177..10763 + 587 Protein_19 serine acetyltransferase -
NIZ22_RS23715 (NIZ22_23695) 11043..11636 - 594 WP_001523457.1 ProQ/FINO family protein -
NIZ22_RS23720 (NIZ22_23700) 12640..13404 + 765 WP_256875923.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 / faeH / faeI 1..79633 79633


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11142.17 Da        Isoelectric Point: 10.6261

>T249636 WP_000222775.1 NZ_CP099879:8608-8895 [Escherichia albertii]
MTYTVKFRDDALREWLKLDKSVQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSHVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9216.45 Da        Isoelectric Point: 4.0927

>AT249636 WP_001139207.1 NZ_CP099879:8360-8611 [Escherichia albertii]
MPSIILSDTSASVSELKKNPMATVSAGEGYPVAILNRNQPAFYCVPAELYERMLDAMDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB T2HS21

Antitoxin

Source ID Structure
AlphaFold DB A0A754EQ65

References