Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 3467..3992 | Replicon | plasmid plas2 |
| Accession | NZ_CP099879 | ||
| Organism | Escherichia albertii strain 247_2_EW_B | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | NIZ22_RS23660 | Protein ID | WP_001159871.1 |
| Coordinates | 3687..3992 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | Q3ZU16 |
| Locus tag | NIZ22_RS23655 | Protein ID | WP_000813639.1 |
| Coordinates | 3467..3685 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ22_RS23620 (NIZ22_23600) | 502..654 | - | 153 | WP_256880789.1 | hypothetical protein | - |
| NIZ22_RS23625 (NIZ22_23605) | 685..981 | - | 297 | WP_001440770.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NIZ22_RS23630 (NIZ22_23610) | 1001..1420 | - | 420 | WP_065106474.1 | transposase | - |
| NIZ22_RS23635 (NIZ22_23615) | 1507..1692 | + | 186 | Protein_4 | transposase | - |
| NIZ22_RS23640 (NIZ22_23620) | 1688..1957 | - | 270 | Protein_5 | site-specific integrase | - |
| NIZ22_RS23645 (NIZ22_23625) | 2017..2613 | - | 597 | WP_059217960.1 | hypothetical protein | - |
| NIZ22_RS23650 (NIZ22_23630) | 2601..2870 | - | 270 | WP_000343793.1 | hypothetical protein | - |
| NIZ22_RS23655 (NIZ22_23635) | 3467..3685 | + | 219 | WP_000813639.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NIZ22_RS23660 (NIZ22_23640) | 3687..3992 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NIZ22_RS23665 (NIZ22_23645) | 3993..4801 | + | 809 | Protein_10 | site-specific integrase | - |
| NIZ22_RS23670 (NIZ22_23650) | 4981..5625 | + | 645 | WP_001144036.1 | ParA family protein | - |
| NIZ22_RS23675 (NIZ22_23655) | 5712..6020 | + | 309 | WP_000030204.1 | molecular chaperone GroEL | - |
| NIZ22_RS23680 (NIZ22_23660) | 6432..7411 | + | 980 | Protein_13 | plasmid segregation protein ParM | - |
| NIZ22_RS23685 (NIZ22_23665) | 7404..7820 | + | 417 | WP_256875925.1 | plasmid partitioning/stability family protein | - |
| NIZ22_RS23690 (NIZ22_23670) | 7822..8245 | - | 424 | Protein_15 | DUF4113 domain-containing protein | - |
| NIZ22_RS23695 (NIZ22_23675) | 8360..8611 | + | 252 | WP_001139207.1 | plasmid stabilization protein | - |
| NIZ22_RS23700 (NIZ22_23680) | 8608..8895 | + | 288 | WP_000222775.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | espL2 / faeH / faeI | 1..79633 | 79633 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T249635 WP_001159871.1 NZ_CP099879:3687-3992 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9DIR5 |