Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3467..3992 Replicon plasmid plas2
Accession NZ_CP099879
Organism Escherichia albertii strain 247_2_EW_B

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NIZ22_RS23660 Protein ID WP_001159871.1
Coordinates 3687..3992 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag NIZ22_RS23655 Protein ID WP_000813639.1
Coordinates 3467..3685 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ22_RS23620 (NIZ22_23600) 502..654 - 153 WP_256880789.1 hypothetical protein -
NIZ22_RS23625 (NIZ22_23605) 685..981 - 297 WP_001440770.1 IS66 family insertion sequence element accessory protein TnpB -
NIZ22_RS23630 (NIZ22_23610) 1001..1420 - 420 WP_065106474.1 transposase -
NIZ22_RS23635 (NIZ22_23615) 1507..1692 + 186 Protein_4 transposase -
NIZ22_RS23640 (NIZ22_23620) 1688..1957 - 270 Protein_5 site-specific integrase -
NIZ22_RS23645 (NIZ22_23625) 2017..2613 - 597 WP_059217960.1 hypothetical protein -
NIZ22_RS23650 (NIZ22_23630) 2601..2870 - 270 WP_000343793.1 hypothetical protein -
NIZ22_RS23655 (NIZ22_23635) 3467..3685 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIZ22_RS23660 (NIZ22_23640) 3687..3992 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NIZ22_RS23665 (NIZ22_23645) 3993..4801 + 809 Protein_10 site-specific integrase -
NIZ22_RS23670 (NIZ22_23650) 4981..5625 + 645 WP_001144036.1 ParA family protein -
NIZ22_RS23675 (NIZ22_23655) 5712..6020 + 309 WP_000030204.1 molecular chaperone GroEL -
NIZ22_RS23680 (NIZ22_23660) 6432..7411 + 980 Protein_13 plasmid segregation protein ParM -
NIZ22_RS23685 (NIZ22_23665) 7404..7820 + 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ22_RS23690 (NIZ22_23670) 7822..8245 - 424 Protein_15 DUF4113 domain-containing protein -
NIZ22_RS23695 (NIZ22_23675) 8360..8611 + 252 WP_001139207.1 plasmid stabilization protein -
NIZ22_RS23700 (NIZ22_23680) 8608..8895 + 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espL2 / faeH / faeI 1..79633 79633


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T249635 WP_001159871.1 NZ_CP099879:3687-3992 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT249635 WP_000813639.1 NZ_CP099879:3467-3685 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References