Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 40419..41217 | Replicon | plasmid plas1 |
Accession | NZ_CP099878 | ||
Organism | Escherichia albertii strain 247_2_EW_B |
Toxin (Protein)
Gene name | ataT | Uniprot ID | E2QDF3 |
Locus tag | NIZ22_RS23095 | Protein ID | WP_000072677.1 |
Coordinates | 40419..40940 (-) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
Locus tag | NIZ22_RS23100 | Protein ID | WP_001351987.1 |
Coordinates | 40948..41217 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ22_RS23080 (NIZ22_23060) | 38968..39291 | + | 324 | WP_000064175.1 | hypothetical protein | - |
NIZ22_RS23085 (NIZ22_23065) | 39305..39997 | + | 693 | WP_012640731.1 | hypothetical protein | - |
NIZ22_RS23090 (NIZ22_23070) | 39999..40250 | + | 252 | WP_000901559.1 | hypothetical protein | - |
NIZ22_RS23095 (NIZ22_23075) | 40419..40940 | - | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
NIZ22_RS23100 (NIZ22_23080) | 40948..41217 | - | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
NIZ22_RS23105 (NIZ22_23085) | 41536..42204 | + | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
NIZ22_RS23110 (NIZ22_23090) | 42210..42563 | + | 354 | WP_160378290.1 | hypothetical protein | - |
NIZ22_RS23115 (NIZ22_23095) | 42616..43383 | - | 768 | WP_000342417.1 | hypothetical protein | - |
NIZ22_RS23120 (NIZ22_23100) | 43666..44406 | + | 741 | WP_187192596.1 | hypothetical protein | - |
NIZ22_RS23125 (NIZ22_23105) | 44450..45790 | + | 1341 | WP_000137333.1 | DnaB-like helicase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..123684 | 123684 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T249634 WP_000072677.1 NZ_CP099878:c40940-40419 [Escherichia albertii]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6P3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6Q7 |